IgG1 Protein, Mouse (HEK293, C102S)

Customer Review

Based on 1 Customer Validation

IgG1 Protein is the most abundant Immunoglobulin G (IgG) subclass in human sera and is important for mediating antibody responses against viral pathogens. IgG1 enables antigen binding activity and immunoglobulin receptor binding activity. It acts upstream of or within several processes, including antibody-dependent cellular cytotoxicity, phagocytosis, and positive regulation of immune response. IgG1 Protein, Mouse (HEK293, C102S) is the recombinant mouse-derived IgG1 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IgG1 Protein is the most abundant Immunoglobulin G (IgG) subclass in human sera and is important for mediating antibody responses against viral pathogens. IgG1 enables antigen binding activity and immunoglobulin receptor binding activity. It acts upstream of or within several processes, including antibody-dependent cellular cytotoxicity, phagocytosis, and positive regulation of immune response. IgG1 Protein, Mouse (HEK293, C102S) is the recombinant mouse-derived IgG1 protein, expressed by HEK293 , with tag free.

Background

Ig gamma-1 chain C region secreted form (IgG1) is the most abundant Immunoglobulin G (IgG) subclass in human sera and is important for mediating antibody responses against viral pathogens. It does so by binding to soluble proteins and membrane protein antigens via its variable domain and concomitantly activating effector mechanisms of the innate immune system. IgG1 enables antigen binding activity and immunoglobulin receptor binding activity. It acts upstream of or within several processes, including antibody-dependent cellular cytotoxicity, phagocytosis, and positive regulation of immune response. IgG1 can effectively bind to C1q causing complement-dependent cytotoxicity (CDC) and can bind to each of the different Fc receptors resulting in antibody-dependent cell-mediated cytotoxicity (ADCC)[1].

Verified Bioactivity

Immobilized Human CD64 (HY-P70669) at 1 μg/mL (100 μL/well) can bind biotinylated Human IgG1. The ED50 for this effect is 68.82 ng/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human CD64 (HY-P70669) at 1 μg/mL (100 μL/well) can bind biotinylated Human IgG1. The ED50 for this effect is 68.82 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IgG1 (V98-K324, C102S)
      Accession # P01868-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IGHG1; Ig Gamma-1 Chain C Region NIE; Immunoglobulin Heavy Constant Gamma 1 (G1m Marker); Ig Gamma-1 Chain C Region KOL; Constant Region Of Heavy Chain Of IgG1; Ig Gamma-1 Chain C Region EU; Immunoglobulin Heavy Constant Gamma 1; Ig Gamma-1 Chain C Region

  • AA Sequence

    VPRDSGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK

  • Predicted Molecular Mass

    25.8 kDa

  • Molecular Weight

    Approximately 32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00