IgG1 Protein, Mouse (HEK293, C102S)

IgG1 Protein is the most abundant Immunoglobulin G (IgG) subclass in human sera and is important for mediating antibody responses against viral pathogens. IgG1 enables antigen binding activity and immunoglobulin receptor binding activity. It acts upstream of or within several processes, including antibody-dependent cellular cytotoxicity, phagocytosis, and positive regulation of immune response. IgG1 Protein, Mouse (HEK293, C102S) is the recombinant mouse-derived IgG1 protein, expressed by HEK293 , with tag free.

Ig gamma-1 chain C region secreted form (IgG1) is the most abundant Immunoglobulin G (IgG) subclass in human sera and is important for mediating antibody responses against viral pathogens. It does so by binding to soluble proteins and membrane protein antigens via its variable domain and concomitantly activating effector mechanisms of the innate immune system. IgG1 enables antigen binding activity and immunoglobulin receptor binding activity. It acts upstream of or within several processes, including antibody-dependent cellular cytotoxicity, phagocytosis, and positive regulation of immune response. IgG1 can effectively bind to C1q causing complement-dependent cytotoxicity (CDC) and can bind to each of the different Fc receptors resulting in antibody-dependent cell-mediated cytotoxicity (ADCC)^[1].

Immobilized Human CD64 (HY-P70669) at 1 μg/mL (100 μL/well) can bind biotinylated Human IgG1. The ED₅₀ for this effect is 68.82 ng/mL.

• 
  Immobilized Human CD64 (HY-P70669) at 1 μg/mL (100 μL/well) can bind biotinylated Human IgG1. The ED₅₀ for this effect is 68.82 ng/mL.

Mouse

HEK293

Tag Free

P01868-1 (V98-K324, C102S)

16017  [NCBI]

Partial

VPRDSGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK

Approximately 32 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.