IgG1 Protein, Mouse (HEK293)
Based on 1 Customer Validation
The immunoglobulin heavy chain constant region is the heavy chain constant region of immunoglobulin. Sequence differences between immunoglobulin heavy chains leads to the various isotypes with different characteristic. IgG1 Protein, Mouse (HEK293) is the recombinant mouse-derived IgG1 protein, expressed by HEK293 , with tag free.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The immunoglobulin heavy chain constant region is the heavy chain constant region of immunoglobulin. Sequence differences between immunoglobulin heavy chains leads to the various isotypes with different characteristic[1][2]. IgG1 Protein, Mouse (HEK293) is the recombinant mouse-derived IgG1 protein, expressed by HEK293 , with tag free.
Background
The immunoglobulin heavy chain constant region is the heavy chain constant region of immunoglobulin. Sequence differences between immunoglobulin heavy chains leads to the various isotypes with different characteristic. The immunoglobulin heavy chain constant region affects kinetic and Tthermodynamic parameters of antibody variable region interactions with antigen[1][2].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
AAK53870.1 (P99-K324)
-
Gene ID/
-
Molecular Construction
-
N-term
-
IgG1 (P99-K324)
Accession # AAK53870.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
immunoglobulin heavy chain constant region, partial; IGHG1; Ig gamma-1 chain C region NIE; Ig gamma-1 chain C region KOL; Ig gamma-1 chain C region E; Ig gamma-1 chain C region EU; Ig gamma-1 chain C region ; Immunoglobulin heavy constant gamma 1; Immunog
-
AA Sequence
PRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
-
Predicted Molecular Mass
25.9 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
