IL-1 alpha Protein, Mouse (HEK293, His)
IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. IL-1 alpha Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-1 alpha protein, expressed by HEK293, with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-1 alpha protein is an important cytokine found intracellularly in non-hematopoietic cells that bridges innate and adaptive immunity. Binds to IL1R1 and IL1RAP to form a high-affinity receptor complex, initiates signaling through MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. IL-1 alpha Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-1 alpha protein, expressed by HEK293, with C-His labeled tag.
Background
The cytokine interleukin-1 alpha (IL-1 alpha), present constitutively intracellularly in almost all quiescent non-hematopoietic cells, serves a crucial role in inflammation and acts as a bridge between the innate and adaptive immune systems. Upon binding to its receptor IL1R1, in conjunction with its accessory protein IL1RAP, it forms the high-affinity interleukin-1 receptor complex. Subsequent signaling events involve the recruitment of adapter molecules such as MYD88, IRAK1, or IRAK4, leading to the activation of NF-kappa-B and the three MAPK pathways—p38, p42/p44, and JNK pathways. Intracellularly, IL-1 alpha functions as an alarmin, and upon cell death, it is released into the extracellular space following cell membrane disruption, inducing inflammation and signaling host response to injury or damage. Beyond its role as a danger signal released during cell necrosis, IL-1 alpha also directly senses DNA damage, serving as a signal for genotoxic stress without compromising cell integrity. Additionally, IL-1 alpha interacts with various proteins, including TMED10, facilitating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Its interaction with IL1R1 and S100A13 further contributes to its intricate regulatory mechanisms, with the latter being a crucial step in the export of IL-1 alpha, involving direct translocation of the complex across the plasma membrane.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P01582 (S115-S270)
-
Gene ID16175
-
Molecular Construction
-
N-term
-
IL-1α (S115-S270)
Accession # P01582 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL1A; IL-1A; Prev. IL1; Preinterleukin 1 Alpha; IL1F1; Interleukin-1 Alpha; Hematopoietin-1; IL-1 Alpha; IL1-ALPHA; Interleukin 1 Alpha; Pro-Interleukin-1-Alpha
-
AA Sequence
SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
-
Predicted Molecular Mass
19.1 kDa
-
Molecular Weight
Approximately 24-23 kDa,based on Bis-Tris PAGE under reducing conditions,due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)