IL-17A Protein, Human (HEK293)

Customer Review

Based on 1 Customer Validation

The IL-17A protein is an important effector cytokine that is critical in both innate and adaptive immunity to defend against microorganisms and maintain tissue integrity. It acts through the IL17RA-IL17RC heterodimeric receptor complex, triggering signaling pathways, activating immune-related gene transcription and promoting strong immune inflammation. IL-17A Protein, Human (HEK293) is the recombinant human-derived IL-17A protein, expressed by HEK293, with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IL-17A protein is an important effector cytokine that is critical in both innate and adaptive immunity to defend against microorganisms and maintain tissue integrity. It acts through the IL17RA-IL17RC heterodimeric receptor complex, triggering signaling pathways, activating immune-related gene transcription and promoting strong immune inflammation. IL-17A Protein, Human (HEK293) is the recombinant human-derived IL-17A protein, expressed by HEK293, with tag free.

Background

The IL-17A Protein is a vital effector cytokine in both innate and adaptive immune responses, playing a crucial role in antimicrobial defense and tissue integrity maintenance. Operating through the IL17RA-IL17RC heterodimeric receptor complex, it triggers downstream signaling pathways, resulting in the transcriptional activation of immune-related genes and potential strong immune inflammation. As a signature effector cytokine of Th17 cells, it induces neutrophil activation and recruitment at infection sites, contributing to host defense against extracellular bacteria and fungi. Additionally, the heterodimer participates in germinal center formation, mediates chemotaxis, and plays a significant role in epithelial barrier maintenance during homeostasis and infection. It forms homodimers and heterodimers, showcasing its versatility in orchestrating diverse immune processes. The IL-17A Protein emerges as a key player in connecting T cell-mediated adaptive immunity with acute inflammatory responses, highlighting its multifaceted role in immune regulation and cellular homeostasis.

Verified Bioactivity

1.Human IL-17A, premium grade stimulates Human IL-17 RA/IL-17 RC (Luc) HEK293 Reporter Cell. The specific activity of Human IL-17A, premium grade is > 1.00×107 IU/mg, which is calibrated against human IL-17 WHO International Standard.
2.Measured by its binding ability in a functional ELISA. Immobilized Human IL17A, premium grade at 0.5 μg/mL (100 μL/well) can bind Human IL-17 RA, His Tag with the EC50 of 30-430 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-17A (G24-A155)
      Accession # Q16552
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc

  • AA Sequence

    GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

  • Predicted Molecular Mass

    15.1 kDa

  • Molecular Weight

    Approximately 16 kDa & 17 kDa & 19 kDa under reduced (R) conditions, 27-34 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 11% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00