1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17A
  6. IL-17A Protein, Human (HEK293)

The IL-17A protein is an important effector cytokine that is critical in both innate and adaptive immunity to defend against microorganisms and maintain tissue integrity. It acts through the IL17RA-IL17RC heterodimeric receptor complex, triggering signaling pathways, activating immune-related gene transcription and promoting strong immune inflammation. IL-17A Protein, Human (HEK293) is the recombinant human-derived IL-17A protein, expressed by HEK293, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-17A protein is an important effector cytokine that is critical in both innate and adaptive immunity to defend against microorganisms and maintain tissue integrity. It acts through the IL17RA-IL17RC heterodimeric receptor complex, triggering signaling pathways, activating immune-related gene transcription and promoting strong immune inflammation. IL-17A Protein, Human (HEK293) is the recombinant human-derived IL-17A protein, expressed by HEK293, with tag free.

Background

The IL-17A Protein is a vital effector cytokine in both innate and adaptive immune responses, playing a crucial role in antimicrobial defense and tissue integrity maintenance. Operating through the IL17RA-IL17RC heterodimeric receptor complex, it triggers downstream signaling pathways, resulting in the transcriptional activation of immune-related genes and potential strong immune inflammation. As a signature effector cytokine of Th17 cells, it induces neutrophil activation and recruitment at infection sites, contributing to host defense against extracellular bacteria and fungi. Additionally, the heterodimer participates in germinal center formation, mediates chemotaxis, and plays a significant role in epithelial barrier maintenance during homeostasis and infection. It forms homodimers and heterodimers, showcasing its versatility in orchestrating diverse immune processes. The IL-17A Protein emerges as a key player in connecting T cell-mediated adaptive immunity with acute inflammatory responses, highlighting its multifaceted role in immune regulation and cellular homeostasis.

Biological Activity

1.Human IL-17A, premium grade stimulates Human IL-17 RA/IL-17 RC (Luc) HEK293 Reporter Cell. The specific activity of Human IL-17A, premium grade is > 1.00×107 IU/mg, which is calibrated against human IL-17 WHO International Standard.
2.Measured by its binding ability in a functional ELISA. Immobilized Human IL17A, premium grade at 0.5 μg/mL (100 μL/well) can bind Human IL-17 RA, His Tag with the EC50 of 30-430 ng/mL.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q16552 (G24-A155)

Gene ID

3605

Molecular Construction
N-term
IL-17A (G24-A155)
Accession # Q16552
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17
AA Sequence

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Predicted Molecular Mass
15.1 kDa
Molecular Weight

Approximately 16 kDa & 17 kDa & 19 kDa under reduced (R) conditions, 27-34 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 11% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-17A Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-17A Protein, Human (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17A Protein, Human (HEK293)
Cat. No.:
HY-P704386
Quantity:
MCE Japan Authorized Agent: