1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17B
  6. IL-17B Protein, Mouse (His)

IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis. IL-17B Protein, Mouse (His) is a recombinant mouse IL-17B protein with His tag at the N-terminus and is expressed in E. coli. It consists of 160 amino acids (H21-F180).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE IL-17B Protein, Mouse (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis[1][2]. IL-17B Protein, Mouse (His) is a recombinant mouse IL-17B protein with His tag at the N-terminus and is expressed in E. coli. It consists of 160 amino acids (H21-F180).

Background

Interleukin-17B (IL-17B) belongs to the IL-17 cytokine family and is a proinflammatory cytokine. IL-17B is expressed in adult pancreas, small intestine, stomach, spinal cord and testis. Murine IL-17B mRNA was detected in the whole mouse embryo[1][3].
The mouse IL-17B shares 88.33% amino acid sequence identity with human.
IL-17B is secreted as a non-covalent dimer glycoprotein. IL-17B shares about 27% amino acid identity with IL-17A and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β in the THP-1 monocytic cell line. The receptor of IL-17B is IL-17RB, which belongs to the IL-17 receptor family. IL-17B shares IL-17RB with IL-17E. IL-17B inhibits IL-17E binding to IL-17RA/IL-17RB complexes, exhibits protumor roles and IL-17E antitumor activities[1][2].
IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis[1].

In Vitro

mIL-17B (50 ng/mL; 24 h) induces IL-1β expression in 3T3 cells, and induces IL-1β, IL-6, and IL-23 expressions in PECs[4].

Species

Mouse

Source

E. coli

Tag

N-8*His

Accession

Q9QXT6 (H21-F180)

Gene ID
Molecular Construction
N-term
8*His
IL-17B (H21-F180)
Accession # Q9QXT6
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL-17B; Cytokine CX1; IL20; interleukin 17B; interleukin 20; MGC138900; MGC138901; NIRF; ZCYTO7
AA Sequence

HPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF

Predicted Molecular Mass
19.1 kDa
Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 2 mM DTT, 300 mM NaCl, 200 mM Arginine, pH 7.0, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-17B Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-17B Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17B Protein, Mouse (His)
Cat. No.:
HY-P78315
Quantity:
MCE Japan Authorized Agent: