Copy Link Print Information

IL-17B Protein, Mouse (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis. IL-17B Protein, Mouse (His) is a recombinant mouse IL-17B protein with His tag at the N-terminus and is expressed in E. coli. It consists of 160 amino acids (H21-F180).

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • IL-17B Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-17B is a proinflammatory cytokine and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β. IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis[1][2]. IL-17B Protein, Mouse (His) is a recombinant mouse IL-17B protein with His tag at the N-terminus and is expressed in E. coli. It consists of 160 amino acids (H21-F180).

Background

Interleukin-17B (IL-17B) belongs to the IL-17 cytokine family and is a proinflammatory cytokine. IL-17B is expressed in adult pancreas, small intestine, stomach, spinal cord and testis. Murine IL-17B mRNA was detected in the whole mouse embryo[1][3].
The mouse IL-17B shares 88.33% amino acid sequence identity with human.
IL-17B is secreted as a non-covalent dimer glycoprotein. IL-17B shares about 27% amino acid identity with IL-17A and stimulates the release of tumour necrosis factor alpha (TNFα) and IL-1β in the THP-1 monocytic cell line. The receptor of IL-17B is IL-17RB, which belongs to the IL-17 receptor family. IL-17B shares IL-17RB with IL-17E. IL-17B inhibits IL-17E binding to IL-17RA/IL-17RB complexes, exhibits protumor roles and IL-17E antitumor activities[1][2].
IL-17B plays an important role in cancer progression, angiogenesis, and inflammatory arthritis[1].

In Vitro

mIL-17B (50 ng/mL; 24 h) induces IL-1β expression in 3T3 cells, and induces IL-1β, IL-6, and IL-23 expressions in PECs[4].

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-8*His
  • Accession

    Q9QXT6 (H21-F180)

  • Gene ID
    56069  [NCBI]
  • Molecular Construction
    • N-term
    • 8*His
    • IL-17B (H21-F180)
      Accession # Q9QXT6
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL17B; MGC138901; Interleukin 17B; Neuronal Interleukin-17 Related Factor; IL-17B; Cytokine-Like Protein ZCYTO7; ZCYTO7; Interleukin-17 Beta; IL-20; Cytokine Zcyto7; NIRF; Interleukin 20; Neuronal Interleukin-17-Related Factor; Interleukin-20; Interleukin

  • AA Sequence

    HPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF

  • Predicted Molecular Mass

    19.1 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 2 mM DTT, 300 mM NaCl, 200 mM Arginine, pH 7.0, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Sanders AJ, et al. IL-17B Can Impact on Endothelial Cellular Traits Linked to Tumour Angiogenesis. J Oncol. 2010;2010:817375. [Content Brief]

[2]. Bastid J, et al. The Emerging Role of the IL-17B/IL-17RB Pathway in Cancer. Front Immunol. 2020 Apr 21;11:718. [Content Brief]

[3]. You Z, et al. Expression of interleukin-17B in mouse embryonic limb buds and regulation by BMP-7 and bFGF. Biochem Biophys Res Commun. 2005 Jan 21;326(3):624-31. [Content Brief]

[4]. Yamaguchi Y, et al. IL-17B and IL-17C are associated with TNF-alpha production and contribute to the exacerbation of inflammatory arthritis. J Immunol. 2007 Nov 15;179(10):7128-36. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • IL-17B Protein, Mouse (His) Product Image
    1/16
  • IL-17B Protein, Mouse (His) Product Image