IL-21 Protein, Rat
Based on 1 Customer Validation
IL-21 Protein, crucial in immune responses and lymphocyte activation, exhibits biased expression in tissues like the thymus and spleen. Predicted to be active in the extracellular space, it serves as a biomarker for periodontal disease and is implicated in conditions like asthma, hepatocellular carcinoma, and systemic lupus erythematosus. IL-21 Protein, Rat is the recombinant rat-derived IL-21 protein, expressed by E. coli , with tag free.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-21 Protein, crucial in immune responses and lymphocyte activation, exhibits biased expression in tissues like the thymus and spleen. Predicted to be active in the extracellular space, it serves as a biomarker for periodontal disease and is implicated in conditions like asthma, hepatocellular carcinoma, and systemic lupus erythematosus. IL-21 Protein, Rat is the recombinant rat-derived IL-21 protein, expressed by E. coli , with tag free.
Background
IL-21 Protein is predicted to possess interleukin-2 receptor binding activity and is anticipated to be involved in various processes, including lymphocyte activation in immune responses, positive regulation of immune effector processes, and tyrosine phosphorylation of STAT protein. Additionally, IL-21 is predicted to act upstream of or within processes such as positive regulation of cytokine production, positive regulation of lymphocyte activation, and positive regulation of tyrosine phosphorylation of STAT protein. The protein is expected to be located in the extracellular space. IL-21 serves as a biomarker for periodontal disease and is implicated in various human conditions, including asthma, common variable immunodeficiency, hepatocellular carcinoma, and systemic lupus erythematosus. Notably, IL-21 exhibits biased expression in tissues such as the thymus and spleen, indicating its potential role in immune regulation within these organs.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Rat IL-21 at 5 μg/mL (100 μL/well) can bind Biotinylated Rat IL-21R Protein. The ED50 for this effect is 12.16 ng/mL.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
A3QPB9/NP_001102413.1 (P25-S146)
-
Molecular Construction
-
N-term
-
IL-21 (P25-S146)
Accession # A3QPB9/NP_001102413.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IL21; Interleukin-21; Interleukin 21; Interleukin; IL-21; CVID11; Za11
-
AA Sequence
PDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS
-
Predicted Molecular Mass
14.5 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
