2. Recombinant Proteins
  3. Immune Checkpoint Proteins CD Antigens
  4. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  5. B7-2/CD86
  6. ILDR2/B7-2 Protein, Human (HEK293, His)

ILDR2/B7-2 Protein, Human (HEK293, His)

Cat. No.: HY-P70864
Handling Instructions

ILDR2/B7-2 proteins play multiple roles in cellular processes, participating in ER stress pathways, affecting lipid homeostasis, and affecting insulin secretion. It is involved in maintaining epithelial barrier function and recruiting MARVELD2/trifibrin into tight junctions, emphasizing its role in cellular integrity. ILDR2/B7-2 Protein, Human (HEK293, His) is the recombinant human-derived ILDR2/B7-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ILDR2/B7-2 Protein, Human (HEK293, His) is 166 a.a., with molecular weight of 45-55 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ILDR2/B7-2 proteins play multiple roles in cellular processes, participating in ER stress pathways, affecting lipid homeostasis, and affecting insulin secretion. It is involved in maintaining epithelial barrier function and recruiting MARVELD2/trifibrin into tight junctions, emphasizing its role in cellular integrity. ILDR2/B7-2 Protein, Human (HEK293, His) is the recombinant human-derived ILDR2/B7-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ILDR2/B7-2 Protein, Human (HEK293, His) is 166 a.a., with molecular weight of 45-55 kDa.
Background

ILDR2/B7-2 Protein appears to be a multifunctional player with diverse roles in cellular processes. It may be involved in ER stress pathways, exerting effects on lipid homeostasis and insulin secretion, thereby implicating its potential significance in metabolic regulation. Alongside ILDR1 and LSR, ILDR2/B7-2 is engaged in maintaining the epithelial barrier function by recruiting MARVELD2/tricellulin to tricellular tight junctions, emphasizing its role in cellular integrity. Furthermore, acting as a member of the B7-like protein family expressed on immune cells and inflamed tissue, ILDR2/B7-2 exhibits T-cell inhibitory activity, suggesting an immunomodulatory function. In the inner ear, it may regulate alternative pre-mRNA splicing through interactions with TRA2A, TRA2B, and SRSF1. The protein's intricate network of interactions, including MARVELD2, OCLN, P4HB, and HSPA5, further underscores its multifaceted nature. Notably, the interaction with HSPA5 stabilizes ILDR2 expression, contributing to its cellular regulation. Understanding the specific mechanisms governing ILDR2/B7-2's diverse functions could provide valuable insights into its roles in metabolic processes, cellular integrity, immunomodulation, and pre-mRNA splicing regulation.
Species

Human
Source

HEK293
Tag

C-6*His
Accession

Q71H61 (L21-E186)
Gene ID
Molecular Construction
N-term
B7-2 (L21-E186)
Accession # Q71H61
6*His
C-term
Synonyms
Angulin-3; C1orf32; Dbsm1; DJ782G3.1; ILDR2; immunoglobulin-like domain containing receptor 2; LISCH-Like
AA Sequence

LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE

Molecular Weight

45-55 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

ILDR2/B7-2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ILDR2/B7-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70864
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.