ILDR2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

ILDR2 proteins play multiple roles in cellular processes, participating in ER stress pathways, affecting lipid homeostasis, and affecting insulin secretion. It is involved in maintaining epithelial barrier function and recruiting MARVELD2/trifibrin into tight junctions, emphasizing its role in cellular integrity. ILDR2 Protein, Human (HEK293, His) is the recombinant human-derived ILDR2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ILDR2 proteins play multiple roles in cellular processes, participating in ER stress pathways, affecting lipid homeostasis, and affecting insulin secretion. It is involved in maintaining epithelial barrier function and recruiting MARVELD2/trifibrin into tight junctions, emphasizing its role in cellular integrity. ILDR2 Protein, Human (HEK293, His) is the recombinant human-derived ILDR2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ILDR2 Protein appears to be a multifunctional player with diverse roles in cellular processes. It may be involved in ER stress pathways, exerting effects on lipid homeostasis and insulin secretion, thereby implicating its potential significance in metabolic regulation. Alongside ILDR1 and LSR, ILDR2 is engaged in maintaining the epithelial barrier function by recruiting MARVELD2/tricellulin to tricellular tight junctions, emphasizing its role in cellular integrity. Furthermore, acting as a member of the B7-like protein family expressed on immune cells and inflamed tissue, ILDR2 exhibits T-cell inhibitory activity, suggesting an immunomodulatory function. In the inner ear, it may regulate alternative pre-mRNA splicing through interactions with TRA2A, TRA2B, and SRSF1. The protein's intricate network of interactions, including MARVELD2, OCLN, P4HB, and HSPA5, further underscores its multifaceted nature. Notably, the interaction with HSPA5 stabilizes ILDR2 expression, contributing to its cellular regulation. Understanding the specific mechanisms governing ILDR2's diverse functions could provide valuable insights into its roles in metabolic processes, cellular integrity, immunomodulation, and pre-mRNA splicing regulation.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ILDR2 (L21-E186)
      Accession # Q71H61
    • 6*His
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    ILDR2; Immunoglobulin-Like Domain Containing Receptor 2; Prev. C1orf32; LISCH-Like; Angulin-3; DJ782G3.1; Immunoglobulin-Like Domain-Containing Receptor 2; Immunoglobulin Like Domain Containing Receptor 2; Chromosome 1 Open Reading Frame 32

  • AA Sequence

    LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE

  • Predicted Molecular Mass

    19.5 kDa

  • Molecular Weight

    Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00