IMPA1 Protein, Human (His)
Based on 1 Customer Validation
IMPA1 protein provides essential inositol for the synthesis of phosphatidylinositol and polyphosphate inositol. IMPA1 Protein, Human (His) is the recombinant human-derived IMPA1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IMPA1 protein provides essential inositol for the synthesis of phosphatidylinositol and polyphosphate inositol. IMPA1 Protein, Human (His) is the recombinant human-derived IMPA1 protein, expressed by E. coli , with N-6*His labeled tag.
Background
The IMPA1 protein plays a crucial role in providing inositol essential for the synthesis of phosphatidylinositol and polyphosphoinositides. Additionally, it has been implicated as the pharmacological target for lithium action in the brain. Demonstrating broad substrate specificity, IMPA1 can utilize various substrates, including myo-inositol monophosphates, myo-inositol 1,3-diphosphate, myo-inositol 1,4-diphosphate, scyllo-inositol-phosphate, D-galactose 1-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P29218-1 (M1-D277)
-
Molecular Construction
-
N-term
-
6*His
-
IMPA1 (M1-D277)
Accession # P29218-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IMPA1; IMPase 1; Prev. IMPA; Testicular Tissue Protein Li 94; Lithium-Sensitive Myo-Inositol Monophosphatase A1; Inositol-Phosphate Phosphatase; Inositol(Myo)-1(Or 4)-Monophosphatase 1; Inositol-1-Monophosphatase; D-Galactose 1-Phosphate Phosphatase; MRT5
-
AA Sequence
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
-
Predicted Molecular Mass
32.3 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.25.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
