IMPA1 Protein, Human (His)

IMPA1 protein provides essential inositol for the synthesis of phosphatidylinositol and polyphosphate inositol. IMPA1 Protein, Human (His) is the recombinant human-derived IMPA1 protein, expressed by E. coli , with N-6*His labeled tag.

The IMPA1 protein plays a crucial role in providing inositol essential for the synthesis of phosphatidylinositol and polyphosphoinositides. Additionally, it has been implicated as the pharmacological target for lithium action in the brain. Demonstrating broad substrate specificity, IMPA1 can utilize various substrates, including myo-inositol monophosphates, myo-inositol 1,3-diphosphate, myo-inositol 1,4-diphosphate, scyllo-inositol-phosphate, D-galactose 1-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P29218-1 (M1-D277)

3612  [NCBI]

Full Length of Isoform-1

MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED

Approximately 33.0 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.25.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.