INSL6 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag.
Background
The INSL6 protein appears to play a crucial role in sperm development and fertilization, implying its involvement in key processes essential for reproductive success. The recognition of its potential function in these intricate stages of male reproductive biology underscores its significance in facilitating the development and maturation of sperm, as well as contributing to the successful fertilization of ova. The precise mechanisms by which INSL6 operates in these processes remain an area of interest, reflecting its potential as a key player in reproductive physiology.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9Y581/NP_009110.2 (R21-F198)
-
Molecular Construction
-
N-term
-
INSL6 (R21-F198)
Accession # Q9Y581/NP_009110.2 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
INSL6; Insulin-Like Peptide INSL6; Insulin Like 6; Insulin-Like Peptide 6; RIF1; Insulin-Like Peptide 5; Relaxin/Insulin-Like Factor 1; Insulin-Like 6
-
AA Sequence
RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF
-
Molecular Weight
Approximately 28-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
