Integrin alpha V Protein, Human (P. pastoris, His)

The Integrin alpha V beta 5 protein, specifically the alpha-V (ITGAV) integrin subunit, serves as a versatile receptor for a range of ligands, including vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, and vWF. Recognizing the sequence R-G-D in various ligands, ITGAV:ITGB3 binds to fractalkine, acting as a coreceptor in CX3CR1-dependent fractalkine signaling. Additionally, it forms essential binding interactions with NRG1, FGF1, FGF2, IGF1, IGF2, IL1B, PLA2G2A, fibrillin-1 (FBN1), and CD40LG, contributing to diverse signaling pathways. Notably, the ITGAV:ITGB3 or ITGAV:ITGB6 complex acts as a receptor for transforming growth factor beta-1 (TGF-beta-1), mediating its release from regulatory Latency-associated peptide (LAP) and playing a crucial role in TGF-beta-1 activation. Furthermore, ITGAV:ITGB5 functions as a receptor for Adenovirus type C during microbial infection. The integrative and multifunctional nature of Integrin alpha V beta 5 underscores its pivotal role in mediating diverse cellular responses and signaling cascades.

Human

P. pastoris

N-6*His

P06756 (D891-T1048)

3685

Partial

DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.