Integrin alpha V Protein, Human (P. pastoris, His)

Customer Review

Based on 1 Customer Validation

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Background

The Integrin alpha V beta 5 protein, specifically the alpha-V (ITGAV) integrin subunit, serves as a versatile receptor for a range of ligands, including vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, and vWF. Recognizing the sequence R-G-D in various ligands, ITGAV:ITGB3 binds to fractalkine, acting as a coreceptor in CX3CR1-dependent fractalkine signaling. Additionally, it forms essential binding interactions with NRG1, FGF1, FGF2, IGF1, IGF2, IL1B, PLA2G2A, fibrillin-1 (FBN1), and CD40LG, contributing to diverse signaling pathways. Notably, the ITGAV:ITGB3 or ITGAV:ITGB6 complex acts as a receptor for transforming growth factor beta-1 (TGF-beta-1), mediating its release from regulatory Latency-associated peptide (LAP) and playing a crucial role in TGF-beta-1 activation. Furthermore, ITGAV:ITGB5 functions as a receptor for Adenovirus type C during microbial infection. The integrative and multifunctional nature of Integrin alpha V beta 5 underscores its pivotal role in mediating diverse cellular responses and signaling cascades.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Integrin alpha V (D891-T1048)
      Accession # P06756
    • 6*His
    • C-term
  • Protein Length

    Full Length of Integrin alpha-V light Chain Chain

  • Synonyms

    ITGAV; Integrin, Alpha V (Vitronectin Receptor, Alpha Polypeptide, Antigen CD51); Prev. MSK8; Vitronectin Receptor; Prev. VNRA; Integrin AlphaVbeta3; Prev. VTNR; Integrin, Alpha V; Vitronectin Receptor Subunit Alpha; CD51 Antigen; Integrin Alpha-V; IDNDC;

  • AA Sequence

    DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

  • Predicted Molecular Mass

    19.7 kDa

  • Molecular Weight

    Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Monomer

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00