Integrin alpha V Protein, Human (P. pastoris, His)
Based on 1 Customer Validation
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Background
The Integrin alpha V beta 5 protein, specifically the alpha-V (ITGAV) integrin subunit, serves as a versatile receptor for a range of ligands, including vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, and vWF. Recognizing the sequence R-G-D in various ligands, ITGAV:ITGB3 binds to fractalkine, acting as a coreceptor in CX3CR1-dependent fractalkine signaling. Additionally, it forms essential binding interactions with NRG1, FGF1, FGF2, IGF1, IGF2, IL1B, PLA2G2A, fibrillin-1 (FBN1), and CD40LG, contributing to diverse signaling pathways. Notably, the ITGAV:ITGB3 or ITGAV:ITGB6 complex acts as a receptor for transforming growth factor beta-1 (TGF-beta-1), mediating its release from regulatory Latency-associated peptide (LAP) and playing a crucial role in TGF-beta-1 activation. Furthermore, ITGAV:ITGB5 functions as a receptor for Adenovirus type C during microbial infection. The integrative and multifunctional nature of Integrin alpha V beta 5 underscores its pivotal role in mediating diverse cellular responses and signaling cascades.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P06756 (D891-T1048)
-
Gene ID3685
-
Molecular Construction
-
N-term
-
Integrin alpha V (D891-T1048)
Accession # P06756 -
6*His
-
C-term
-
-
Protein Length
Full Length of Integrin alpha-V light Chain Chain
-
Synonyms
ITGAV; Integrin, Alpha V (Vitronectin Receptor, Alpha Polypeptide, Antigen CD51); Prev. MSK8; Vitronectin Receptor; Prev. VNRA; Integrin AlphaVbeta3; Prev. VTNR; Integrin, Alpha V; Vitronectin Receptor Subunit Alpha; CD51 Antigen; Integrin Alpha-V; IDNDC;
-
AA Sequence
DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
-
Predicted Molecular Mass
19.7 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
