ITM2B Protein, Human (HEK293, His)
Based on 1 Customer Validation
The ITM2B protein regulates amyloid beta A4 precursor protein (APP) processing by inhibiting amyloid beta peptide aggregation and fibril deposition. In addition to its effects on the amyloid-β pathway, ITM2B also contributes to neurite outgrowth, affecting neurobiological processes. ITM2B Protein, Human (HEK293, His) is the recombinant human-derived ITM2B protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The ITM2B protein regulates amyloid beta A4 precursor protein (APP) processing by inhibiting amyloid beta peptide aggregation and fibril deposition. In addition to its effects on the amyloid-β pathway, ITM2B also contributes to neurite outgrowth, affecting neurobiological processes. ITM2B Protein, Human (HEK293, His) is the recombinant human-derived ITM2B protein, expressed by HEK293 , with C-6*His labeled tag.
Background
ITM2B assumes a regulatory role in the intricate processing of the amyloid-beta A4 precursor protein (APP) and serves as an inhibitor, effectively impeding the aggregation and fibril deposition of amyloid-beta peptides. Beyond its influence on amyloid-beta pathways, ITM2B plays a pivotal role in the induction of neurite outgrowth, contributing to neurobiological processes. Furthermore, ITM2B acts as a protease inhibitor by strategically blocking access of secretases to critical APP cleavage sites. In its mature form (mBRI2), ITM2B serves as a potent modulator of APP processing, resulting in a substantial reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42, thereby highlighting its multifaceted role in cellular homeostasis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9Y287 (Y76-S266)
-
Molecular Construction
-
N-term
-
ITM2B (Y76-S266 )
Accession # Q9Y287 -
6*His
-
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
ITM2B; ImBRI2; Integral Membrane Protein 2B; Epididymis Secretory Sperm Binding Protein; BRI2; Integral Membrane Protein 2; BRI; ABri/ADan Amyloid Peptide; BRICD2B; Protein E25B; E3-16; RDGCA; E25B; ABRI; BRICHOS Domain Containing 2B; FBD; Transmembrane P
-
AA Sequence
YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS
-
Predicted Molecular Mass
23.3 kDa
-
Molecular Weight
Approximately 29-33 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of 20 mM Acetate, 10% trehalose, 25 mM NaCl, 10% glycerol, 0.05% Tween 80, pH 4.5.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
