JAM-A/CD321 Protein, Mouse (HEK293, His)
The JAM-A/CD321 protein is critical for the formation of epithelial tight junctions and is present at primitive cell junctions where it recruits PARD3.This association may hinder PARD3-JAM1 interaction and thus tight junction assembly.JAM-A/CD321 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-A/CD321 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The JAM-A/CD321 protein is critical for the formation of epithelial tight junctions and is present at primitive cell junctions where it recruits PARD3.This association may hinder PARD3-JAM1 interaction and thus tight junction assembly.JAM-A/CD321 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-A/CD321 protein, expressed by HEK293 , with C-His labeled tag.
Background
JAM-A/CD321 protein plays a crucial role in the formation of epithelial tight junctions and is present early in primordial cell junctions, where it recruits PARD3. The association of the PARD6-PARD3 complex may hinder the interaction between PARD3 and JAM1, thereby preventing the assembly of tight junctions. Furthermore, JAM-A is involved in regulating monocyte transmigration, contributing to the integrity of the epithelial barrier. Acting as a ligand for integrin alpha-L/beta-2, it participates in the transmigration of memory T-cells and neutrophils. Additionally, JAM-A is implicated in platelet activation and interacts with the ninth PDZ domain of MPDZ. Its interaction with the first PDZ domain of PARD3 may be disrupted by the association between PARD3 and PARD6B. Furthermore, JAM-A interacts with ITGAL (via I-domain), further highlighting its multifaceted involvement in cellular processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
O88792 (K27-G238)
-
Molecular Construction
-
N-term
-
JAM-A (K27-G238)
Accession # O88792 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
F11R; JAM-A; Prev. JAM1; JAMA; Junctional Adhesion Molecule 1; Platelet Adhesion Molecule 1; PAM-1; Platelet F11 Receptor; JCAM; CD321 Antigen; Junctional Adhesion Molecule A; JAM; JAM-1; KAT; F11 Receptor; CD321
-
AA Sequence
KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGG
-
Predicted Molecular Mass
23.9 kDa
-
Molecular Weight
Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
