Latexin Protein, Human (His)
Based on 1 Customer Validation
Latexin, a protein, powerfully inhibits CPA1, CPA2, and CPA4, playing a crucial role in controlling carboxypeptidase activity. It may also regulate inflammation, expanding its physiological significance beyond enzyme inhibition. Latexin Protein, Human (His) is the recombinant human-derived Latexin protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Latexin, a protein, powerfully inhibits CPA1, CPA2, and CPA4, playing a crucial role in controlling carboxypeptidase activity. It may also regulate inflammation, expanding its physiological significance beyond enzyme inhibition. Latexin Protein, Human (His) is the recombinant human-derived Latexin protein, expressed by E. coli , with N-His labeled tag.
Latexin, a protein of significance, functions as a robust, hardly reversible, and non-competitive inhibitor targeting CPA1, CPA2, and CPA4. Its inhibitory prowess underscores its potential role in modulating the activity of carboxypeptidases, contributing to intricate cellular processes. Notably, Latexin may also partake in the regulation of inflammation, suggesting its involvement in broader physiological contexts beyond enzyme inhibition.
Measured by its ability to inhibit carboxypeptidase A1 cleavage of the colorimetric peptide substrate Ac-Phe-Thiaphe-OH in the presence of 5,5’Dithio-bis (2-nitrobenzoic acid) (DTNB). The IC50 value is <2.5 nM, as measured under the described conditions. (Activation description: The proenzyme needs to be activated by Trypsin for an activated form.)
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9BS40/NP_064554.3 (E2-E222)
-
Molecular Construction
-
N-term
-
His
-
Latexin (E2-E222)
Accession # Q9BS40/NP_064554.3 -
C-term
-
-
Protein Length
Partial
-
Synonyms
LXN; ECI; Latexin; TCI; Endogenous Carboxypeptidase Inhibitor; Protein MUM; Tissue Carboxypeptidase Inhibitor; MUM
-
AA Sequence
EIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
-
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 300 mM NaCl, pH 7.5.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
