LCN8 Protein, Human (HEK293, His)
The LCN8 protein may play a crucial role in male fertility, serving as a retinoid carrier in the epididymis and contributing to important processes in reproductive function. Its involvement in retinoid transport and regulation highlights its importance, particularly in spermatogenesis. LCN8 Protein, Human (HEK293, His) is the recombinant human-derived LCN8 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LCN8 protein may play a crucial role in male fertility, serving as a retinoid carrier in the epididymis and contributing to important processes in reproductive function. Its involvement in retinoid transport and regulation highlights its importance, particularly in spermatogenesis. LCN8 Protein, Human (HEK293, His) is the recombinant human-derived LCN8 protein, expressed by HEK293 , with C-His labeled tag.
Background
The LCN8 protein is implicated in potentially playing a crucial role in male fertility, suggesting its involvement in essential processes related to reproductive function. Notably, LCN8 may act as a retinoid carrier protein within the epididymis, underscoring its potential significance in the transport and regulation of retinoids, which are essential for various cellular processes, including spermatogenesis. The specific mechanisms by which LCN8 contributes to male fertility and its precise role as a retinoid carrier in the epididymis remain areas of interest, warranting further exploration to unravel its functional significance and molecular interactions in the context of reproductive biology.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q6JVE9-2/NP_848564.2 (M1-I152)
-
Molecular Construction
-
N-term
-
LCN8 (M1-I152)
Accession # Q6JVE9-2/NP_848564.2 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
LCN8; Epididymal-Specific Lipocalin-8; Prev. LCN5; Chromosome 9 Open Reading Frame 137; Epididymis Secretory Sperm Binding Protein; EP17; Lipocalin 8; Lipocalin 5
-
AA Sequence
MEELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYNSSGSCEIEKIVGSEIDSTGKFAFPGHREIHVLDTDYEGYAILRVSLMWRGRNFRVLKYFTRSLEDKDRLGFWKFRELTADTGLYLAARPGRCAELLKEELI
-
Predicted Molecular Mass
18.7 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
