LIF Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation.It also stimulates acute-phase protein synthesis in hepatocytes.LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses.LIF Protein, Mouse (HEK293, His) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation.It also stimulates acute-phase protein synthesis in hepatocytes.LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses.LIF Protein, Mouse (HEK293, His) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with C-His labeled tag.
LIF (Leukemia Inhibitory Factor) exhibits the capability to prompt terminal differentiation in leukemic cells, showcasing a diverse range of activities. Notably, it induces hematopoietic differentiation in both normal and myeloid leukemia cells, facilitates neuronal cell differentiation, and stimulates the synthesis of acute-phase proteins in hepatocytes. This multifaceted role underscores LIF's significance in orchestrating various cellular processes, contributing to the regulation of hematopoiesis, neurogenesis, and hepatic responses.
Measured by its ability to inhibit the proliferation of M1 mouse myeloid leukemia cells. The ED50 for this effect is typically 0.1-0.5 ng/ml.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P09056 (S24-F203)
-
Molecular Construction
-
N-term
-
LIF (S24-F203)
Accession # P09056 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
LIF; Hepatocyte-Stimulating Factor III; LIF Interleukin 6 Family Cytokine; Differentiation-Inducing Factor; HILDA; Melanoma-Derived LPL Inhibitor; Leukemia Inhibitory Factor; Human Interleukin In DA Cells; CDF; D Factor; DIA; MLPLI; Differentiation Inhibi
-
AA Sequence
SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
-
Predicted Molecular Mass
21.3 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
