Copy Link Print Information

LIF Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

Lif Protein, a cytokine, plays a vital role in cell proliferation, differentiation, and immune response regulation. Dysregulation of Lif Protein has been linked to various diseases, including cancer and inflammatory disorders. Targeting Lif Protein may offer potential therapeutic interventions in these conditions by modulating cell growth, promoting immune regulation, and suppressing inflammation. LIF Protein, Rat (HEK293, His) is the recombinant rat-derived LIF protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for LIF Protein, Rat (HEK293, His)
  • Experimental Validation Results for LIF Protein, Rat (HEK293, His)
  • LIF Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Lif Protein, a cytokine, plays a vital role in cell proliferation, differentiation, and immune response regulation. Dysregulation of Lif Protein has been linked to various diseases, including cancer and inflammatory disorders. Targeting Lif Protein may offer potential therapeutic interventions in these conditions by modulating cell growth, promoting immune regulation, and suppressing inflammation. LIF Protein, Rat (HEK293, His) is the recombinant rat-derived LIF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Integrin alpha-2/beta-1, also known as ITGA2 protein, functions as a receptor for various extracellular matrix molecules including laminin, collagen, collagen C-propeptides, fibronectin, and E-cadherin. It specifically recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. This integrin plays a crucial role in mediating the adhesion of platelets and other cells to collagens. Additionally, it modulates the expression of collagen and collagenase genes, generates mechanical forces, and organizes newly synthesized extracellular matrix. In the context of microbial infection, the ITGA2:ITGB1 complex acts as a receptor for Human rotavirus A.

Verified Bioactivity

Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 0.2365 ng/mL, corresponding to a specific activity is 4.23×10^6 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 0.2365 ng/mL, corresponding to a specific activity is 4.23×106 units/mg.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession

    P17777 (S23-F202)

  • Gene ID
    60584  [NCBI]
  • Molecular Construction
    • N-term
    • LIF (S23-F202)
      Accession # P17777
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    LIF; Hepatocyte-Stimulating Factor III; LIF Interleukin 6 Family Cytokine; Differentiation-Inducing Factor; HILDA; Melanoma-Derived LPL Inhibitor; Leukemia Inhibitory Factor; Human Interleukin In DA Cells; CDF; D Factor; DIA; MLPLI; Differentiation Inhibi

  • AA Sequence

    SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF

  • Predicted Molecular Mass

    19.8 kDa

  • Molecular Weight

    Approximately 30-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 0.2365 ng/mL, corresponding to a specific activity is 4.23×106 units/mg.

  • LIF Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for LIF Protein, Rat (HEK293, His)
  • Experimental Validation Results for LIF Protein, Rat (HEK293, His)
  • LIF Protein, Rat (HEK293, His) Product Image