LTC4S Protein, Human (sf9, His)

LTC4S protein catalyzes the specific binding of leukotriene A4 and reduced glutathione (GSH) to generate leukotriene C4. LTC4S Protein, Human (sf9, His) is the recombinant human-derived LTC4S protein, expressed by Sf9 insect cells , with C-His labeled tag.

LTC4S plays a crucial role in cellular processes by catalyzing the conjugation of leukotriene A4 with reduced glutathione (GSH), yielding the bioactive lipid mediator leukotriene C4 with remarkable specificity. This enzymatic activity is pivotal in the regulation of inflammation and immune responses. Additionally, LTC4S demonstrates versatility by facilitating the transfer of a glutathionyl group from glutathione (GSH) to 13(S),14(S)-epoxy-docosahexaenoic acid, resulting in the formation of maresin conjugate in tissue regeneration 1 (MCTR1). Notably, MCTR1 possesses potent anti-inflammatory and proresolving actions, emphasizing the multifaceted nature of LTC4S in mediating lipid metabolism and inflammation.

Human

Sf9 insect cells

C-His

Q16873 (M1-A150)

4056  [NCBI]

Full Length

MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

Approximately 17 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.