LTC4S Protein, Human (sf9, His)
LTC4S protein catalyzes the specific binding of leukotriene A4 and reduced glutathione (GSH) to generate leukotriene C4. LTC4S Protein, Human (sf9, His) is the recombinant human-derived LTC4S protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LTC4S protein catalyzes the specific binding of leukotriene A4 and reduced glutathione (GSH) to generate leukotriene C4. LTC4S Protein, Human (sf9, His) is the recombinant human-derived LTC4S protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
LTC4S plays a crucial role in cellular processes by catalyzing the conjugation of leukotriene A4 with reduced glutathione (GSH), yielding the bioactive lipid mediator leukotriene C4 with remarkable specificity. This enzymatic activity is pivotal in the regulation of inflammation and immune responses. Additionally, LTC4S demonstrates versatility by facilitating the transfer of a glutathionyl group from glutathione (GSH) to 13(S),14(S)-epoxy-docosahexaenoic acid, resulting in the formation of maresin conjugate in tissue regeneration 1 (MCTR1). Notably, MCTR1 possesses potent anti-inflammatory and proresolving actions, emphasizing the multifaceted nature of LTC4S in mediating lipid metabolism and inflammation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q16873 (M1-A150)
-
Molecular Construction
-
N-term
-
LTC4S (M1-A150)
Accession # Q16873 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
LTC4S; LTC4 Synthase; Leukotriene C4 Synthase; MGC33147; Glutathione S-Transferase LTC4; Leukotriene-C4 Synthase; Leukotriene-C(4) Synthase
-
AA Sequence
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA
-
Predicted Molecular Mass
17 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
