1. Recombinant Proteins
  2. Others
  3. LTC4S Protein, Human (sf9, His)

LTC4S protein catalyzes the specific binding of leukotriene A4 and reduced glutathione (GSH) to generate leukotriene C4. LTC4S Protein, Human (sf9, His) is the recombinant human-derived LTC4S protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LTC4S protein catalyzes the specific binding of leukotriene A4 and reduced glutathione (GSH) to generate leukotriene C4. LTC4S Protein, Human (sf9, His) is the recombinant human-derived LTC4S protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

LTC4S plays a crucial role in cellular processes by catalyzing the conjugation of leukotriene A4 with reduced glutathione (GSH), yielding the bioactive lipid mediator leukotriene C4 with remarkable specificity. This enzymatic activity is pivotal in the regulation of inflammation and immune responses. Additionally, LTC4S demonstrates versatility by facilitating the transfer of a glutathionyl group from glutathione (GSH) to 13(S),14(S)-epoxy-docosahexaenoic acid, resulting in the formation of maresin conjugate in tissue regeneration 1 (MCTR1). Notably, MCTR1 possesses potent anti-inflammatory and proresolving actions, emphasizing the multifaceted nature of LTC4S in mediating lipid metabolism and inflammation.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q16873 (M1-A150)

Gene ID
Molecular Construction
N-term
LTC4S (M1-A150)
Accession # Q16873
His
C-term
Protein Length

Full Length

Synonyms
Leukotriene C4 synthase; LTC4 synthase; LTC4S
AA Sequence

MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

Predicted Molecular Mass
17 kDa
Molecular Weight

Approximately 17 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LTC4S Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LTC4S Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LTC4S Protein, Human (sf9, His)
Cat. No.:
HY-P75919
Quantity:
MCE Japan Authorized Agent: