CHRM2 Protein, Human (HEK293, Flag)
CHRM2 Protein, Human (HEK293, Flag) is the recombinant human-derived M2R, expressed by HEK293 , with Flag labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CHRM2 Protein, Human (HEK293, Flag) is the recombinant human-derived M2R, expressed by HEK293 , with Flag labeled tag.
Background
M2R is a muscarinic acetylcholine receptor that mediates various cellular responses through the action of G proteins, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels. Its primary transducing effect is adenylate cyclase inhibition. Signaling by this receptor promotes phospholipase C activity, leading to the release of inositol trisphosphate (IP3), which then triggers calcium ion release into the cytosol. by similar: The receptor's signaling pathway involves the regulation of multiple secondary messengers and ion channels.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Flag
-
Accession
P08172 (M1-I217, N2D, N3D, N6D, N9D, P377-R466)
-
Gene ID1129
-
Protein Length
Partial
-
Synonyms
CHRM2; M2 Muscarinic Acetylcholine Receptor; Cholinergic Receptor Muscarinic 2; Muscarinic Acetylcholine Receptor; Acetylcholine Receptor, Muscarinic 2; 7TM Receptor; Muscarinic Acetylcholine Receptor M2; HM2; Muscarinic M2 Receptor
-
AA Sequence
PPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
-
Predicted Molecular Mass
54.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
