MAP4K4 Protein, Human (Active, sf9, GST)

MAP4K4 Protein, Human (sf9, GST) is the recombinant human-derived MAP4K4, expressed by Sf9 insect cells , with GST labeled tag. ,

HGK is a serine/threonine kinase involved in the response to environmental stress and cytokines such as TNF-alpha. It appears to act upstream of the JUN N-terminal pathway. As an activator of the Hippo signaling pathway, it plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. MAP4Ks function in parallel to and partially redundantly with STK3/MST2 and STK4/MST2 in the phosphorylation and activation of LATS1/2, establishing MAP4Ks as components of the expanded Hippo pathway. Additionally, HGK phosphorylates SMAD1 at Thr-322.

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 0.15 nM, the conversion rate is about 23%.

Human

Sf9 insect cells

N-GST

O95819-1 (A2-E328)

9448

Partial

ANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEE

Approximately 64.1 KDa

≥ 80%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5% glycerol, 5 mM DTT, 0.1 M trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.