MAPK1/ERK2 Protein, Human (Inactive, GST)
ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (Inactive, GST) is the recombinant human-derived MAPK1/ERK2 protein, expressed by E. coli, with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (Inactive, GST) is the recombinant human-derived MAPK1/ERK2 protein, expressed by E. coli, with N-GST labeled tag.
Background
The MAPK/ERK cascade plays a crucial role in the regulation of various cellular processes, including transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. It achieves this by phosphorylating a multitude of substrates, including transcription factors, cytoskeletal elements, regulators of apoptosis, regulators of translation, protein kinases, and phosphatases.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P28482-1 (M1-S360)
-
Gene ID5594
-
Molecular Construction
-
N-term
-
GST
-
MAPK1/ERK2 (M1-S360)
Accession # P28482-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MAPK1; MAPK 2; Prev. PRKM1; ERT1; Prev. PRKM2; Mitogen-Activated Protein Kinase; ERK2; Protein Tyrosine Kinase ERK2; Extracellular Signal-Regulated Kinase 2; MAP Kinase Isoform P42; P41mapk; P42MAPK; MAPK2; MAPK 1; ERK; NS13; Mitogen-Activated Protein Kin
-
AA Sequence
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
-
Predicted Molecular Mass
67.7 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
