MDK/Midkine Protein, Mouse (His)
Based on 1 Customer Validation
Midkine (MDK) is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors.It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration.MDK/Midkine Protein, Mouse (His) is the recombinant mouse-derived MDK/Midkine protein, expressed by E.coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Midkine (MDK) is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors.It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration.MDK/Midkine Protein, Mouse (His) is the recombinant mouse-derived MDK/Midkine protein, expressed by E.coli , with N-His labeled tag.
Background
Midkine (MDK) is a secreted protein functioning as a versatile cytokine and growth factor, transmitting signals through both cell-surface proteoglycan and non-proteoglycan receptors. It engages in diverse cellular processes, such as inflammatory response, cell proliferation, adhesion, survival, tissue regeneration, differentiation, and migration. MDK plays a pivotal role in inflammatory processes by orchestrating the recruitment of neutrophils and macrophages to inflammation sites, exhibiting dual activities that include promoting epithelial cell survival and facilitating smooth muscle cell migration following renal and vessel damage. Moreover, MDK suppresses tolerogenic dendritic cell development, inhibiting regulatory T cell differentiation, and fosters T cell expansion through NFAT signaling, influencing Th1 cell differentiation. The protein's involvement extends to tissue regeneration, contributing to heart damage recovery by negatively regulating inflammatory cell recruitment and mediating cell survival through MAPKs and AKT pathways. Additionally, MDK facilitates liver regeneration, bone repair, and brain development, promoting neural precursor cell survival, neurite outgrowth, and embryonic neurons' survival. Its interactions with various receptors, such as PTPRZ1, ITGA4:ITGB1 complex, LRP1, and GPC2, underscore MDK's intricate regulatory role in diverse physiological processes.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-8*His
-
Accession
P12025 (K23-D140)
-
Molecular Construction
-
N-term
-
8*His
-
MDK (K23-D140)
Accession # P12025 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MDK; Midgestation And Kidney Protein; Prev. NEGF2; ARAP; MK; Neurite Outgrowth-Promoting Protein; Neurite Outgrowth-Promoting Factor 2; Retinoic Acid Inducible Factor; Neurite Growth-Promoting Factor 2; Mutant Truncated Midkine B; Amphiregulin-Associated
-
AA Sequence
KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
-
Predicted Molecular Mass
14 kDa
-
Molecular Weight
Approximately 18-23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 350 mM NaCl, 200 mM L-Arginine, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)