MDK/Midkine Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

Midkine (MDK) is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors.It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration.MDK/Midkine Protein, Mouse (His) is the recombinant mouse-derived MDK/Midkine protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Midkine (MDK) is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors.It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration.MDK/Midkine Protein, Mouse (His) is the recombinant mouse-derived MDK/Midkine protein, expressed by E.coli , with N-His labeled tag.

Background

Midkine (MDK) is a secreted protein functioning as a versatile cytokine and growth factor, transmitting signals through both cell-surface proteoglycan and non-proteoglycan receptors. It engages in diverse cellular processes, such as inflammatory response, cell proliferation, adhesion, survival, tissue regeneration, differentiation, and migration. MDK plays a pivotal role in inflammatory processes by orchestrating the recruitment of neutrophils and macrophages to inflammation sites, exhibiting dual activities that include promoting epithelial cell survival and facilitating smooth muscle cell migration following renal and vessel damage. Moreover, MDK suppresses tolerogenic dendritic cell development, inhibiting regulatory T cell differentiation, and fosters T cell expansion through NFAT signaling, influencing Th1 cell differentiation. The protein's involvement extends to tissue regeneration, contributing to heart damage recovery by negatively regulating inflammatory cell recruitment and mediating cell survival through MAPKs and AKT pathways. Additionally, MDK facilitates liver regeneration, bone repair, and brain development, promoting neural precursor cell survival, neurite outgrowth, and embryonic neurons' survival. Its interactions with various receptors, such as PTPRZ1, ITGA4:ITGB1 complex, LRP1, and GPC2, underscore MDK's intricate regulatory role in diverse physiological processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • MDK (K23-D140)
      Accession # P12025
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    MDK; Midgestation And Kidney Protein; Prev. NEGF2; ARAP; MK; Neurite Outgrowth-Promoting Protein; Neurite Outgrowth-Promoting Factor 2; Retinoic Acid Inducible Factor; Neurite Growth-Promoting Factor 2; Mutant Truncated Midkine B; Amphiregulin-Associated

  • AA Sequence

    KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD

  • Predicted Molecular Mass

    14 kDa

  • Molecular Weight

    Approximately 18-23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 350 mM NaCl, 200 mM L-Arginine, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00