Pleiotrophin Protein, Mouse (HEK293, His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Pleiotrophin (PTN) is a secreted growth factor that transduces signals through cell surface proteoglycan and non-proteoglycan receptors.PTN binds to chondroitin sulfate (CS) groups and regulates cell proliferation, survival, and differentiation, particularly inhibiting long-term synaptic potentiation of neurons.Pleiotrophin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Pleiotrophin protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Pleiotrophin (PTN) is a secreted growth factor that transduces signals through cell surface proteoglycan and non-proteoglycan receptors.PTN binds to chondroitin sulfate (CS) groups and regulates cell proliferation, survival, and differentiation, particularly inhibiting long-term synaptic potentiation of neurons.Pleiotrophin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Pleiotrophin protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Pleiotrophin (PTN) is a secreted growth factor that transduces its signal through both cell-surface proteoglycan and non-proteoglycan receptors. It binds to the chondroitin sulfate (CS) groups of cell-surface proteoglycan receptors, regulating crucial processes such as cell proliferation, survival, growth, differentiation, and migration in various tissues, including neurons and bone. PTN plays a pivotal role in synaptic plasticity and learning-related behavior by inhibiting long-term synaptic potentiation. Through binding to PTPRZ1, PTN neutralizes the negative charges of the CS chains, inducing PTPRZ1 clustering and subsequent inactivation of its phosphatase activity. This leads to increased tyrosine phosphorylation of PTPRZ1 substrates, such as ALK or AFAP1L2, activating the PI3K-AKT pathway. PTN also forms complexes with PTPRZ1 and integrin alpha-V/beta-3, stimulating endothelial cell migration. In the adult hippocampus, PTN promotes dendritic arborization, spine development, and functional integration of newborn granule neurons through ALK and AKT signaling. Additionally, PTN interacts with GPC2, SDC3, and other receptors, mediating diverse functions related to bone formation, neural stem cell proliferation and differentiation, hematopoietic regeneration, and various physiological processes in the female reproductive system and auditory response. The intricate network of PTN interactions underscores its multifaceted role in cellular and tissue-level regulatory mechanisms.

Verified Bioactivity

Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 3-8 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 5.024 μg/mL, corresponding to a specific activity is 199.045 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Pleiotrophin (G33-D168)
      Accession # P63089
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PTN; HBNF-1; Prev. NEGF1; HBBM; HBNF; Pleiotrophin (Heparin Binding Growth Factor 8, Neurite Growth-Promoting Factor 1); HBGF8; Heparin-Binding Neurite Outgrowth Promoting Factor; Heparin-Binding Neurite Outgrowth-Promoting Factor 1; Heparin-Binding Neuri

  • AA Sequence

    GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

  • Predicted Molecular Mass

    16.1 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00