MDK/Midkine Protein, Mouse
Based on 1 publication(s) in Google Scholar
Midkine (MDK) is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration. MDK/Midkine Protein, Mouse is the recombinant mouse-derived Midkine protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Midkine (MDK) is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration. MDK/Midkine Protein, Mouse is the recombinant mouse-derived Midkine protein, expressed by E. coli , with tag free.
Background
Midkine (MDK) is a secreted protein functioning as a versatile cytokine and growth factor, transmitting signals through both cell-surface proteoglycan and non-proteoglycan receptors. It engages in diverse cellular processes, such as inflammatory response, cell proliferation, adhesion, survival, tissue regeneration, differentiation, and migration. MDK plays a pivotal role in inflammatory processes by orchestrating the recruitment of neutrophils and macrophages to inflammation sites, exhibiting dual activities that include promoting epithelial cell survival and facilitating smooth muscle cell migration following renal and vessel damage. Moreover, MDK suppresses tolerogenic dendritic cell development, inhibiting regulatory T cell differentiation, and fosters T cell expansion through NFAT signaling, influencing Th1 cell differentiation. The protein's involvement extends to tissue regeneration, contributing to heart damage recovery by negatively regulating inflammatory cell recruitment and mediating cell survival through MAPKs and AKT pathways. Additionally, MDK facilitates liver regeneration, bone repair, and brain development, promoting neural precursor cell survival, neurite outgrowth, and embryonic neurons' survival. Its interactions with various receptors, such as PTPRZ1, ITGA4:ITGB1 complex, LRP1, and GPC2, underscore MDK's intricate regulatory role in diverse physiological processes.
Verified Bioactivity
1.Measured by its binding ability in a functional ELISA. Immobilized Human Midkine Protein at 2 μg/mL (100 μL/well) can bind Human LRP-6, mFc (HY-P77990). The ED50 for this effect is 10-120 ng/mL.
2.Immobilized Human Midkine Protein at 2 μg/mL (100 μL/well) can bind Biotinylated Human LRP-6 (HY-P77990). The ED50 for this effect is 20-50 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
Unraveling the Role of MDK-SDC4 Interaction in Pancreatic Cancer-Associated New-Onset Diabetes by Single-Cell Transcriptomic Analysis. [Abstract]2025 Jul 25:e09987. PMID: 40709672
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P12025 (K23-D140)
-
Molecular Construction
-
N-term
-
Midkine (K23-D140)
Accession # P12025 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MDK; Midgestation And Kidney Protein; Prev. NEGF2; ARAP; MK; Neurite Outgrowth-Promoting Protein; Neurite Outgrowth-Promoting Factor 2; Retinoic Acid Inducible Factor; Neurite Growth-Promoting Factor 2; Mutant Truncated Midkine B; Amphiregulin-Associated Protein; MK1; Midkine; FLJ27379
-
AA Sequence
KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
-
Predicted Molecular Mass
13.1 kDa
-
Molecular Weight
Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 500 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)