MDM2 Protein, Human (His)
Based on 1 Customer Validation
MDM2 protein is a key E3 ubiquitin protein ligase that coordinates cellular processes by ubiquitinating and degrading p53/TP53 and inhibiting its tumor suppressor function. In addition to p53/TP53 regulation, MDM2 inhibits p53/TP53- and p73/TP73-mediated responses, self-ubiquitinates, and targets ARRB1 for degradation. MDM2 Protein, Human (His) is the recombinant human-derived MDM2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
MDM2 protein is a key E3 ubiquitin protein ligase that coordinates cellular processes by ubiquitinating and degrading p53/TP53 and inhibiting its tumor suppressor function. In addition to p53/TP53 regulation, MDM2 inhibits p53/TP53- and p73/TP73-mediated responses, self-ubiquitinates, and targets ARRB1 for degradation. MDM2 Protein, Human (His) is the recombinant human-derived MDM2 protein, expressed by E. coli , with N-6*His labeled tag.
MDM2 Protein, an E3 ubiquitin-protein ligase, plays a central role in the intricate regulation of cellular processes by mediating the ubiquitination and subsequent proteasomal degradation of the tumor suppressor p53/TP53, leading to its downregulation. Beyond its interaction with p53/TP53, MDM2 inhibits p53/TP53- and p73/TP73-mediated cell cycle arrest and apoptosis by binding to their transcriptional activation domain, highlighting its role as a negative regulator of these critical cellular responses. Not limited to its interactions with p53/TP53, MDM2 functions as a ubiquitin ligase E3 toward itself and ARRB1, permitting the nuclear export of p53/TP53 and promoting the proteasome-dependent ubiquitin-independent degradation of retinoblastoma RB1 protein. Additionally, MDM2 inhibits DAXX-mediated apoptosis by inducing its ubiquitination and degradation, demonstrating its versatile involvement in apoptotic pathways. As a component of various complexes, including TRIM28/KAP1-MDM2-p53/TP53 and TRIM28/KAP1-ERBB4-MDM2, MDM2 links growth factor and DNA damage response pathways. It further mediates ubiquitination and proteasome degradation of DYRK2, IGF1R, SNAI1, DCX, and DLG4, influencing diverse cellular functions such as dendritic spine density, receptor endocytosis, and mitochondrial respiration. Through its interactions with NDUFS1, MDM2 negatively regulates mitochondrial respiration, leading to increased oxidative stress and commitment to the mitochondrial pathway of apoptosis. These multifaceted roles underscore the intricate regulatory functions of MDM2 in cellular homeostasis and stress responses.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q00987 (S17-N111)
-
Gene ID4193
-
Molecular Construction
-
N-term
-
6*His
-
MDM2 (S17-N111)
Accession # Q00987 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MDM2; MDM2 Oncogene, E3 Ubiquitin Protein Ligase; MDM2 Proto-Oncogene; Mdm2 P53 Binding Protein Homolog (Mouse); HDM2; P53-Binding Protein; E3 Ubiquitin-Protein Ligase Mdm2; MDM2 Variant FB55; Oncoprotein Mdm2; MDM2 Variant FB30; MDM2 Proto-Oncogene, E3 U
-
AA Sequence
SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN
-
Predicted Molecular Mass
13.1 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.0, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)