1. Recombinant Proteins
  2. Others
  3. MID1IP1 Protein, Human (His)

Mid1-interacting protein 1 plays a role in the regulation of lipogenesis in liver and up-regulates ACACA enzyme activity. Mid1-interacting protein 1 required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Mid1-interacting protein 1 involved in stabilization of microtubules. MID1IP1 Protein, Human (His) is the recombinant human-derived MID1IP1 protein, expressed by E. coli , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

Mid1-interacting protein 1 plays a role in the regulation of lipogenesis in liver and up-regulates ACACA enzyme activity. Mid1-interacting protein 1 required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Mid1-interacting protein 1 involved in stabilization of microtubules. MID1IP1 Protein, Human (His) is the recombinant human-derived MID1IP1 protein, expressed by E. coli , with N-His labeled tag.

Background

Mid1-interacting protein 1 enables identical protein binding activity and protein C-terminus binding activity. Mid1-interacting protein 1 is involved in several processes, including negative regulation of microtubule depolymerization; positive regulation of fatty acid biosynthetic process; and protein polymerization. Mid1-interacting protein 1 is located in cytoplasm and microtubule cytoskeleton and is active in cytosol[1][2].

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9NPA3 (M1-H183)

Gene ID
Molecular Construction
N-term
His
MID1IP1 (M1-H183)
Accession # Q9NPA3
C-term
Protein Length

Full Length

Synonyms
Mid1-interacting protein 1; Protein STRAIT11499; Spot 14-related protein; S14R; MIG12
AA Sequence

MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH

Peso molecular

Approximately 25 kDa.

Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

MID1IP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

MID1IP1 Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
MID1IP1 Protein, Human (His)
Cat. No.:
HY-P76497
Cantidad:
MCE Japan Authorized Agent: