MID1IP1 Protein, Human (His)
Based on 1 Customer Validation
Mid1-interacting protein 1 plays a role in the regulation of lipogenesis in liver and up-regulates ACACA enzyme activity. Mid1-interacting protein 1 required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Mid1-interacting protein 1 involved in stabilization of microtubules. MID1IP1 Protein, Human (His) is the recombinant human-derived MID1IP1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Mid1-interacting protein 1 plays a role in the regulation of lipogenesis in liver and up-regulates ACACA enzyme activity. Mid1-interacting protein 1 required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Mid1-interacting protein 1 involved in stabilization of microtubules. MID1IP1 Protein, Human (His) is the recombinant human-derived MID1IP1 protein, expressed by E. coli , with N-His labeled tag.
Background
Mid1-interacting protein 1 enables identical protein binding activity and protein C-terminus binding activity. Mid1-interacting protein 1 is involved in several processes, including negative regulation of microtubule depolymerization; positive regulation of fatty acid biosynthetic process; and protein polymerization. Mid1-interacting protein 1 is located in cytoplasm and microtubule cytoskeleton and is active in cytosol[1][2].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9NPA3 (M1-H183)
-
Molecular Construction
-
N-term
-
His
-
MID1IP1 (M1-H183)
Accession # Q9NPA3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MID1IP1; S14R; MID1 Interacting Protein 1; MID1 Interacting Protein 1 (Gastrulation Specific G12-Like (Zebrafish)); MIG12; MID1 Interacting Protein 1 (Gastrulation Specific G12-Like); STRAIT11499; Gastrulation Specific G12 Homolog (Zebrafish); G12-Like; G
-
AA Sequence
MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)