MID1IP1 Protein, Human (His)

Mid1-interacting protein 1 plays a role in the regulation of lipogenesis in liver and up-regulates ACACA enzyme activity. Mid1-interacting protein 1 required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Mid1-interacting protein 1 involved in stabilization of microtubules. MID1IP1 Protein, Human (His) is the recombinant human-derived MID1IP1 protein, expressed by E. coli , with N-His labeled tag.

Mid1-interacting protein 1 enables identical protein binding activity and protein C-terminus binding activity. Mid1-interacting protein 1 is involved in several processes, including negative regulation of microtubule depolymerization; positive regulation of fatty acid biosynthetic process; and protein polymerization. Mid1-interacting protein 1 is located in cytoplasm and microtubule cytoskeleton and is active in cytosol^[1][2].

Human

E. coli

N-6*His

Q9NPA3 (M1-H183)

58526  [NCBI]

Full Length

MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.