MIF Protein, Human (HEK293, His)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (HEK293, His) is the recombinant human-derived MIF protein, expressed by HEK293 , with C-His labeled tag.

MIF Protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens. Its expression at sites of inflammation suggests its involvement in regulating macrophage function in host defense. MIF counteracts the anti-inflammatory effects of glucocorticoids. Although MIF has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro, the physiological substrate of MIF is still unknown. It remains unclear whether the tautomerase activity is relevant to its cytokine activity.

Human

HEK293

C-8*His

P14174 (P2-A115)

4282  [NCBI]

Full Length of Mature Protein

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.