MIF Protein, Mouse (P. pastoris, His)

The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived MIF protein, expressed by P.pastoris , with N-6*His labeled tag.

MIF Protein, a pro-inflammatory cytokine, plays a crucial role in the innate immune response to bacterial pathogens. Its expression at inflammatory sites suggests its involvement as a mediator in regulating macrophage function during host defense. Notably, MIF counters the anti-inflammatory activity of glucocorticoids. While it exhibits phenylpyruvate tautomerase and dopachrome tautomerase activities in vitro, the physiological substrate remains unknown. The significance of its tautomerase activity and its relevance to cytokine function remain unclear.

Measured by its ability to inhibit THP-1 cells migration. The ED₅₀ for this effect is 34 ng/mL, corresponding to a specific activity is 2.941×10^4 U/mg.

• 
  Measured by its ability to inhibit THP-1 cells migration. The ED₅₀ for this effect is 34 ng/mL, corresponding to a specific activity is 2.941×10^4 U/mg.

Mouse

P. pastoris

N-6*His

P34884 (P2-A115)

17319  [NCBI]

Full Length of Mature Protein

PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.