Copy Link Print Information

MIF Protein, Mouse (P. pastoris, His)

Customer Review

Based on 1 Customer Validation

The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived MIF protein, expressed by P.pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for MIF Protein, Mouse (P. pastoris, His)
  • MIF Protein, Mouse (P. pastoris, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived MIF protein, expressed by P.pastoris , with N-6*His labeled tag.

Background

MIF Protein, a pro-inflammatory cytokine, plays a crucial role in the innate immune response to bacterial pathogens. Its expression at inflammatory sites suggests its involvement as a mediator in regulating macrophage function during host defense. Notably, MIF counters the anti-inflammatory activity of glucocorticoids. While it exhibits phenylpyruvate tautomerase and dopachrome tautomerase activities in vitro, the physiological substrate remains unknown. The significance of its tautomerase activity and its relevance to cytokine function remain unclear.

Verified Bioactivity

Measured by its ability to inhibit THP-1 cells migration. The ED50 for this effect is 34 ng/mL, corresponding to a specific activity is 2.941×10^4 U/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit THP-1 cells migration. The ED50 for this effect is 34 ng/mL, corresponding to a specific activity is 2.941×10^4 U/mg.

Technical Parameters

  • Species Mouse
  • Source P. pastoris
  • Tag N-6*His
  • Accession

    P34884 (P2-A115)

  • Gene ID
    17319  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • MIF (P2-A115)
      Accession # P34884
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    MIF; L-Dopachrome Isomerase; Prev. GLIF; Glycosylation-Inhibiting Factor; Phenylpyruvate Tautomerase; MMIF; GIF; Epididymis Secretory Sperm Binding Protein; L-Dopachrome Tautomerase; Macrophage Migration Inhibitory Factor; Macrophage Migration Inhibitory

  • AA Sequence

    PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

  • Predicted Molecular Mass

    13.9 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit THP-1 cells migration. The ED50 for this effect is 34 ng/mL, corresponding to a specific activity is 2.941×10^4 U/mg.

  • MIF Protein, Mouse (P. pastoris, His) Product Image
    1/16
  • Experimental Validation Results for MIF Protein, Mouse (P. pastoris, His)
  • MIF Protein, Mouse (P. pastoris, His) Product Image