1. Recombinant Proteins
  2. Others
  3. MMGT1 Protein, Human (HEK293, His)

The MMGT1 protein is an important member of the endoplasmic reticulum membrane protein complex (EMC) and is essential for the independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum (ER) membrane. Its preference for transmembrane domains with weak hydrophobicity or unstable characteristics guides co- and post-translational insertion processes. MMGT1 Protein, Human (HEK293, His) is the recombinant human-derived MMGT1 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MMGT1 protein is an important member of the endoplasmic reticulum membrane protein complex (EMC) and is essential for the independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum (ER) membrane. Its preference for transmembrane domains with weak hydrophobicity or unstable characteristics guides co- and post-translational insertion processes. MMGT1 Protein, Human (HEK293, His) is the recombinant human-derived MMGT1 protein, expressed by HEK293 , with N-His labeled tag.

Background

MMGT1 protein is an essential component of the endoplasmic reticulum membrane protein complex (EMC), playing a crucial role in the energy-independent insertion of newly synthesized membrane proteins into endoplasmic reticulum (ER) membranes. It exhibits a preference for accommodating proteins with transmembrane domains that possess weak hydrophobicity or contain destabilizing features, such as charged and aromatic residues. MMGT1 is actively involved in both cotranslational and post-translational insertion processes. In cotranslational insertion, it facilitates the proper positioning of N-terminal transmembrane domains in an N-exo topology, ensuring the translocated N-terminus resides in the ER lumen, particularly impacting the topology of multi-pass membrane proteins like G protein-coupled receptors. Moreover, MMGT1 indirectly influences various cellular processes by regulating the insertion of diverse proteins into membranes. Additionally, it is implicated in Mg(2+) transport and operates as a key constituent of the EMC.

Species

Human

Source

HEK293

Tag

N-His

Accession

Q8N4V1-1/NP_775741.1 (E66-R131)

Gene ID
Molecular Construction
N-term
His
MMGT1 (E66-R131)
Accession # Q8N4V1-1/NP_775741.1
C-term
Protein Length

Partial

Synonyms
ER membrane protein complex subunit 5; Transmembrane protein 32; EMC5; TMEM32
AA Sequence

EFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR

Predicted Molecular Mass
10.1 kDa
Molecular Weight

Approximately 23-29 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MMGT1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MMGT1 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMGT1 Protein, Human (HEK293, His)
Cat. No.:
HY-P77087
Quantity:
MCE Japan Authorized Agent: