MMGT1 Protein, Human (HEK293, His)
The MMGT1 protein is an important member of the endoplasmic reticulum membrane protein complex (EMC) and is essential for the independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum (ER) membrane. Its preference for transmembrane domains with weak hydrophobicity or unstable characteristics guides co- and post-translational insertion processes. MMGT1 Protein, Human (HEK293, His) is the recombinant human-derived MMGT1 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MMGT1 protein is an important member of the endoplasmic reticulum membrane protein complex (EMC) and is essential for the independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum (ER) membrane. Its preference for transmembrane domains with weak hydrophobicity or unstable characteristics guides co- and post-translational insertion processes. MMGT1 Protein, Human (HEK293, His) is the recombinant human-derived MMGT1 protein, expressed by HEK293 , with N-His labeled tag.
Background
MMGT1 protein is an essential component of the endoplasmic reticulum membrane protein complex (EMC), playing a crucial role in the energy-independent insertion of newly synthesized membrane proteins into endoplasmic reticulum (ER) membranes. It exhibits a preference for accommodating proteins with transmembrane domains that possess weak hydrophobicity or contain destabilizing features, such as charged and aromatic residues. MMGT1 is actively involved in both cotranslational and post-translational insertion processes. In cotranslational insertion, it facilitates the proper positioning of N-terminal transmembrane domains in an N-exo topology, ensuring the translocated N-terminus resides in the ER lumen, particularly impacting the topology of multi-pass membrane proteins like G protein-coupled receptors. Moreover, MMGT1 indirectly influences various cellular processes by regulating the insertion of diverse proteins into membranes. Additionally, it is implicated in Mg(2+) transport and operates as a key constituent of the EMC.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q8N4V1-1/NP_775741.1 (E66-R131)
-
Molecular Construction
-
N-term
-
His
-
MMGT1 (E66-R131)
Accession # Q8N4V1-1/NP_775741.1 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
MMGT1; ER Membrane Protein Complex Subunit 5; Prev. TMEM32; Membrane Magnesium Transporter; EMC5; Membrane Magnesium Transporter 1; Transmembrane Protein 32
-
AA Sequence
EFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR
-
Predicted Molecular Mass
10.1 kDa
-
Molecular Weight
Approximately 23-29 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
