MMGT1 Protein, Human (HEK293, His)

The MMGT1 protein is an important member of the endoplasmic reticulum membrane protein complex (EMC) and is essential for the independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum (ER) membrane. Its preference for transmembrane domains with weak hydrophobicity or unstable characteristics guides co- and post-translational insertion processes. MMGT1 Protein, Human (HEK293, His) is the recombinant human-derived MMGT1 protein, expressed by HEK293 , with N-His labeled tag.

MMGT1 protein is an essential component of the endoplasmic reticulum membrane protein complex (EMC), playing a crucial role in the energy-independent insertion of newly synthesized membrane proteins into endoplasmic reticulum (ER) membranes. It exhibits a preference for accommodating proteins with transmembrane domains that possess weak hydrophobicity or contain destabilizing features, such as charged and aromatic residues. MMGT1 is actively involved in both cotranslational and post-translational insertion processes. In cotranslational insertion, it facilitates the proper positioning of N-terminal transmembrane domains in an N-exo topology, ensuring the translocated N-terminus resides in the ER lumen, particularly impacting the topology of multi-pass membrane proteins like G protein-coupled receptors. Moreover, MMGT1 indirectly influences various cellular processes by regulating the insertion of diverse proteins into membranes. Additionally, it is implicated in Mg(2+) transport and operates as a key constituent of the EMC.

Human

HEK293

N-His

Q8N4V1-1/NP_775741.1 (E66-R131)

93380  [NCBI]

Partial

EFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR

Approximately 23-29 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.