MMP-8 Protein, Mouse (CHO, His)
MMP-8 protein degrades different fibrillar collagens, such as type I, II, and III.It is implicated in the breakdown of collagen fibers during uterine involution.MMP-8 Protein, Mouse (CHO, His) is the recombinant mouse-derived MMP-8 protein, expressed by CHO , with C-His labeled tag.
- Species: Mouse
- Source: CHO
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MMP-8 protein degrades different fibrillar collagens, such as type I, II, and III.It is implicated in the breakdown of collagen fibers during uterine involution.MMP-8 Protein, Mouse (CHO, His) is the recombinant mouse-derived MMP-8 protein, expressed by CHO , with C-His labeled tag.
Technical Parameters
-
Species Mouse
-
Source CHO
-
Tag C-His
-
Accession
O70138 (F21-S465)
-
Molecular Construction
-
N-term
-
MMP-8 (F21-S465)
Accession # O70138 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
MMP8; PMNL Collagenase; Prev. CLG1; MMP-8; Matrix Metalloproteinase 8 (Neutrophil Collagenase); PMN Leukocyte Collagenase; Matrix Metalloproteinase-8; Collagenase 2; Neutrophil Collagenase; HNC; Matrix Metallopeptidase 8; PMNL-CL
-
AA Sequence
FPVPEHLEEKNIKTAENYLRKFYNLPSNQFRSSRNATMVAEKLKEMQRFFSLAETGKLDAATMGIMEMPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPIQPTGPSTPKACDPHLRFDATTTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSGYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFINNQCWRYDNQRRSMDPGYPKSIPSMFPGVNCRVDAVFLQDSFFLFFSGPQYFAFNFVSHRVTRVARSNLWLNCS
-
Predicted Molecular Mass
52.2 kDa
-
Molecular Weight
Approximately 57 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
