MRAP Protein, Human (HEK293, hFc)

MRAP protein crucially modulates melanocortin receptors (MC1R, MC2R, MC3R, MC4R, and MC5R), enhancing ligand sensitivity and amplifying cAMP generation. Its role extends to promoting MC2R cell surface expression in adrenal cells for corticotropin (ACTH) signaling and potential involvement in adipocyte intracellular trafficking pathways. MRAP forms antiparallel homodimers and heterodimers, engaging with a range of melanocortin receptors. MRAP Protein, Human (HEK293, hFc) is the recombinant human-derived MRAP protein, expressed by HEK293 , with N-hFc labeled tag.

MRAP protein serves as a crucial modulator for melanocortin receptors (MC1R, MC2R, MC3R, MC4R, and MC5R), exerting its effects by enhancing ligand sensitivity and amplifying cAMP generation in response to receptor activation. It plays a vital role in facilitating the cell surface expression of MC2R in adrenal cells, promoting signaling in response to corticotropin (ACTH). Additionally, MRAP may participate in intracellular trafficking pathways within adipocyte cells. This protein forms homodimers and heterodimers, both as antiparallel structures, and interacts with a spectrum of melanocortin receptors, namely MC1R, MC2R, MC3R, MC4R, and MC5R.

Human

HEK293

N-hFc

Q8TCY5-4 (Y59-S172)

56246  [NCBI]

Partial

YMSWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS

Approximately 45-58 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.