MRAP Protein, Human (HEK293, hFc)
Based on 5 publication(s) in Google Scholar
MRAP protein crucially modulates melanocortin receptors (MC1R, MC2R, MC3R, MC4R, and MC5R), enhancing ligand sensitivity and amplifying cAMP generation. Its role extends to promoting MC2R cell surface expression in adrenal cells for corticotropin (ACTH) signaling and potential involvement in adipocyte intracellular trafficking pathways. MRAP forms antiparallel homodimers and heterodimers, engaging with a range of melanocortin receptors. MRAP Protein, Human (HEK293, hFc) is the recombinant human-derived MRAP protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
MRAP protein crucially modulates melanocortin receptors (MC1R, MC2R, MC3R, MC4R, and MC5R), enhancing ligand sensitivity and amplifying cAMP generation. Its role extends to promoting MC2R cell surface expression in adrenal cells for corticotropin (ACTH) signaling and potential involvement in adipocyte intracellular trafficking pathways. MRAP forms antiparallel homodimers and heterodimers, engaging with a range of melanocortin receptors. MRAP Protein, Human (HEK293, hFc) is the recombinant human-derived MRAP protein, expressed by HEK293 , with N-hFc labeled tag.
Background
MRAP protein serves as a crucial modulator for melanocortin receptors (MC1R, MC2R, MC3R, MC4R, and MC5R), exerting its effects by enhancing ligand sensitivity and amplifying cAMP generation in response to receptor activation. It plays a vital role in facilitating the cell surface expression of MC2R in adrenal cells, promoting signaling in response to corticotropin (ACTH). Additionally, MRAP may participate in intracellular trafficking pathways within adipocyte cells. This protein forms homodimers and heterodimers, both as antiparallel structures, and interacts with a spectrum of melanocortin receptors, namely MC1R, MC2R, MC3R, MC4R, and MC5R.
Publications (5)
-
Journal Impact Factor
-
Most Recent
-
MedComm (2020)
Feedback loop LINC00511-YTHDF2-SOX2 regulatory network drives cholangiocarcinoma progression and stemness. [Abstract]2024 Oct 22;5(11):e743. PMID: 39445001 -
Cancer Lett
2024 Aug 10:597:217068. PMID: 38901665 -
World J Surg Oncol
IFIT3 accelerates the progression of head and neck squamous cell carcinoma by targeting PD-L1 to activate PI3K/AKT signaling pathway. [Abstract]2024 Jan 25;22(1):34. PMID: 38273364 -
Clin Transl Oncol
Hypoxia promotes conversion to a stem cell phenotype in prostate cancer cells by activating HIF-1α/Notch1 signaling pathway. [Abstract]2023 Jul;25(7):2138-2152. PMID: 36757381 -
J Gastrointest Oncol
Promotion of hepatocellular carcinoma stemness and progression by abnormal spindle-like microcephaly-associated protein via the Wnt/β-catenin pathway. [Abstract]2024 Aug 31;15(4):1613-1626. PMID: 39279956
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q8TCY5-4 (Y59-S172)
-
Molecular Construction
-
N-term
-
hFc
-
MRAP (Y59-S172)
Accession # Q8TCY5-4 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MRAP; Fat Cell-Specific Low Molecular Weight Protein; Prev. C21orf61; Fat Tissue-Specific Low MW Protein; FALP; Chromosome 21 Open Reading Frame 61; B27; GCCD2; MRAP1; Melanocortin 2 Receptor Accessory Protein; Melanocortin-2 Receptor Accessory Protein
-
AA Sequence
YMSWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
-
Predicted Molecular Mass
40.9 kDa
-
Molecular Weight
Approximately 45-58 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)