Copy Link Print Information

MRAP Protein, Human (HEK293, hFc)

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

MRAP protein crucially modulates melanocortin receptors (MC1R, MC2R, MC3R, MC4R, and MC5R), enhancing ligand sensitivity and amplifying cAMP generation. Its role extends to promoting MC2R cell surface expression in adrenal cells for corticotropin (ACTH) signaling and potential involvement in adipocyte intracellular trafficking pathways. MRAP forms antiparallel homodimers and heterodimers, engaging with a range of melanocortin receptors. MRAP Protein, Human (HEK293, hFc) is the recombinant human-derived MRAP protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for MRAP Protein, Human (HEK293, hFc)
  • MRAP Protein, Human (HEK293, hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MRAP protein crucially modulates melanocortin receptors (MC1R, MC2R, MC3R, MC4R, and MC5R), enhancing ligand sensitivity and amplifying cAMP generation. Its role extends to promoting MC2R cell surface expression in adrenal cells for corticotropin (ACTH) signaling and potential involvement in adipocyte intracellular trafficking pathways. MRAP forms antiparallel homodimers and heterodimers, engaging with a range of melanocortin receptors. MRAP Protein, Human (HEK293, hFc) is the recombinant human-derived MRAP protein, expressed by HEK293 , with N-hFc labeled tag.

Background

MRAP protein serves as a crucial modulator for melanocortin receptors (MC1R, MC2R, MC3R, MC4R, and MC5R), exerting its effects by enhancing ligand sensitivity and amplifying cAMP generation in response to receptor activation. It plays a vital role in facilitating the cell surface expression of MC2R in adrenal cells, promoting signaling in response to corticotropin (ACTH). Additionally, MRAP may participate in intracellular trafficking pathways within adipocyte cells. This protein forms homodimers and heterodimers, both as antiparallel structures, and interacts with a spectrum of melanocortin receptors, namely MC1R, MC2R, MC3R, MC4R, and MC5R.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession

    Q8TCY5-4 (Y59-S172)

  • Gene ID
    56246  [NCBI]
  • Molecular Construction
    • N-term
    • hFc
    • MRAP (Y59-S172)
      Accession # Q8TCY5-4
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MRAP; Fat Cell-Specific Low Molecular Weight Protein; Prev. C21orf61; Fat Tissue-Specific Low MW Protein; FALP; Chromosome 21 Open Reading Frame 61; B27; GCCD2; MRAP1; Melanocortin 2 Receptor Accessory Protein; Melanocortin-2 Receptor Accessory Protein

  • AA Sequence

    YMSWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS

  • Predicted Molecular Mass

    40.9 kDa

  • Molecular Weight

    Approximately 45-58 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • MRAP Protein, Human (HEK293, hFc) Product Image
    1/16
  • Experimental Validation Results for MRAP Protein, Human (HEK293, hFc)
  • MRAP Protein, Human (HEK293, hFc) Product Image