MTSS1 Protein, Human (His)
Based on 1 Customer Validation
MTSS1 Protein is a protein down-regulated in MTSS1 in metastatic bladder carcinoma cell lines. MTSS1 is widely expressed but most abundant in spleen, thymus, testis, prostate and peripheral blood, with low levels also detected in uterus and colon. MTSS1 is proposed to function as a metastatic suppressor protein in both bladder and prostate cancers. MTSS1 Protein, Human (His) is the recombinant human-derived MTSS1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MTSS1 Protein is a protein down-regulated in MTSS1 in metastatic bladder carcinoma cell lines. MTSS1 is widely expressed but most abundant in spleen, thymus, testis, prostate and peripheral blood, with low levels also detected in uterus and colon. MTSS1 is proposed to function as a metastatic suppressor protein in both bladder and prostate cancers. MTSS1 Protein, Human (His) is the recombinant human-derived MTSS1 protein, expressed by E. coli , with N-His labeled tag.
Background
MTSS1 Protein is a protein down-regulated in MTSS1 in metastatic bladder carcinoma cell lines. MTSS1 is widely expressed but most abundant in spleen, thymus, testis, prostate and peripheral blood, with low levels also detected in uterus and colon. MTSS1 is proposed to function as a metastatic suppressor protein in both bladder and prostate cancers. MTSS1 enables actin monomer binding activity, dentical protein binding activity and signaling receptor binding activity. MTSS1 is involved in cellular response to fluid shear stress, negative regulation of epithelial cell proliferation and urogenital system development. MTSS1 acts upstream of or within several processes, including actin filament polymerization, adherens junction maintenance and magnesium ion homeostasis. MTSS1 is located in actin Cytoskeleton[1].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
EAW92073 (M1-S250)
-
Molecular Construction
-
N-term
-
His-MBP
-
MTSS1 (M1-S250)
Accession # EAW92073 -
C-term
-
-
Protein Length
Full Length of IMD Domain
-
Synonyms
MTSS1; MTSS1, I-BAR Domain Containing; MTSS I-BAR Domain Containing 1; Missing In Metastasis Protein; MIM; Metastasis Suppressor YGL-1; KIAA0429; Metastasis Suppressor 1; MIMA; Protein MTSS 1; MIMB; Missing In Metastasis; Metastasis Suppressor Protein 1;
-
AA Sequence
MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGS
-
Predicted Molecular Mass
28.2 kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
