Copy Link Print Information

NBL1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

NBL1 protein, identified as a potential tumor suppressor gene in neuroblastoma, plays a crucial role in inhibiting cells from progressing into the critical G1/S stage of the transformation process. Functioning as a homodimer, NBL1 underscores its involvement in regulatory mechanisms governing cellular transformation and emphasizes its potential contributions to maintaining normal cellular growth control. NBL1 Protein, Human (HEK293, His) is the recombinant human-derived NBL1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for NBL1 Protein, Human (HEK293, His)
  • Experimental Validation Results for NBL1 Protein, Human (HEK293, His)
  • NBL1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

NBL1 protein, identified as a potential tumor suppressor gene in neuroblastoma, plays a crucial role in inhibiting cells from progressing into the critical G1/S stage of the transformation process. Functioning as a homodimer, NBL1 underscores its involvement in regulatory mechanisms governing cellular transformation and emphasizes its potential contributions to maintaining normal cellular growth control. NBL1 Protein, Human (HEK293, His) is the recombinant human-derived NBL1 protein, expressed by HEK293 , with C-His labeled tag.

Background

NBL1 protein emerges as a potential tumor suppressor gene in neuroblastoma, suggesting its pivotal role in impeding cells from progressing into the critical G1/S stage of the transformation process. Notably, NBL1 functions as a homodimer, highlighting its involvement in regulatory mechanisms that govern cellular transformation and underscoring its potential contributions to the maintenance of normal cellular growth control.

Verified Bioactivity

Measured by its ability to inhibit BMP-4-induced activity in MC3T3‑E1 mouse preosteoblast cells. The ED50 for this effect is 0.3530 µg/mL in the presence of 50 ng/mL of rhBMP-4, corresponding to a specific activity is 2.833×103 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit BMP-4-induced activity in MC3T3‑E1 mouse preosteoblast cells. The ED50 for this effect is 0.3530 µg/mL in the presence of 50 ng/mL of rhBMP-4., corresponding to a specific activity is 2.833 ×103 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    P41271 (A17-D181)

  • Gene ID
    100532736  [NCBI]/4681  [NCBI]
  • Molecular Construction
    • N-term
    • NBL1 (A17-D181)
      Accession # P41271
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    NBL1; Neuroblastoma Candidate Region, Suppression Of Tumorigenicity 1; NBL1, DAN Family BMP Antagonist; Differential Screening-Selected Gene Aberrant In Neuroblastoma; Neuroblastoma Suppressor Of Tumorigenicity 1; Neuroblastoma 1, DAN Family BMP Antagonis

  • AA Sequence

    AAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit BMP-4-induced activity in MC3T3‑E1 mouse preosteoblast cells. The ED50 for this effect is 0.3530 µg/mL in the presence of 50 ng/mL of rhBMP-4., corresponding to a specific activity is 2.833 ×103 U/mg.

  • NBL1 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for NBL1 Protein, Human (HEK293, His)
  • Experimental Validation Results for NBL1 Protein, Human (HEK293, His)
  • NBL1 Protein, Human (HEK293, His) Product Image