NBL1 Protein, Human (HEK293, His)

NBL1 protein, identified as a potential tumor suppressor gene in neuroblastoma, plays a crucial role in inhibiting cells from progressing into the critical G1/S stage of the transformation process. Functioning as a homodimer, NBL1 underscores its involvement in regulatory mechanisms governing cellular transformation and emphasizes its potential contributions to maintaining normal cellular growth control. NBL1 Protein, Human (HEK293, His) is the recombinant human-derived NBL1 protein, expressed by HEK293 , with C-His labeled tag.

NBL1 protein emerges as a potential tumor suppressor gene in neuroblastoma, suggesting its pivotal role in impeding cells from progressing into the critical G1/S stage of the transformation process. Notably, NBL1 functions as a homodimer, highlighting its involvement in regulatory mechanisms that govern cellular transformation and underscoring its potential contributions to the maintenance of normal cellular growth control.

Measured by its ability to inhibit BMP-4-induced activity in MC3T3‑E1 mouse preosteoblast cells. The ED₅₀ for this effect is 0.3530 µg/mL in the presence of 50 ng/mL of rhBMP-4, corresponding to a specific activity is 2.833×10³ U/mg.

• 
  Measured by its ability to inhibit BMP-4-induced activity in MC3T3‑E1 mouse preosteoblast cells. The ED₅₀ for this effect is 0.3530 µg/mL in the presence of 50 ng/mL of rhBMP-4., corresponding to a specific activity is 2.833 ×10³ U/mg.

Human

HEK293

C-His

P41271 (A17-D181)

100532736  [NCBI]/4681  [NCBI]

Full Length of Mature Protein

AAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED

Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.