Nectin-2/CD112 Protein, Human (HEK293, His-Avi)

Nectin-2/CD112 protein has dual roles in T-cell signaling: as a costimulator with CD226, promoting proliferation and cytokine production, and as a coinhibitor with PVRIG, inhibiting proliferation. It also acts as a cell adhesion protein and a receptor for certain viruses. Nectin-2/CD112 Protein, Human (HEK293, His-Avi) is the recombinant human-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Nectin-2/CD112 protein has dual roles in T-cell signaling: as a costimulator with CD226, promoting proliferation and cytokine production, and as a coinhibitor with PVRIG, inhibiting proliferation. It also acts as a cell adhesion protein and a receptor for certain viruses. Nectin-2/CD112 Protein, Human (HEK293, His-Avi) is the recombinant human-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

Background

Nectin-2/CD112, a versatile modulator of T-cell signaling, exhibits dual roles as a costimulator or coinhibitor, contingent upon the receptor it engages. Binding to CD226 prompts the stimulation of T-cell proliferation and cytokine production, including key players like IL2, IL5, IL10, IL13, and IFNG. In contrast, interaction with PVRIG results in the inhibition of T-cell proliferation, and these engagements are competitive in nature. Additionally, Nectin-2/CD112 serves as a probable cell adhesion protein, as indicated in previous studies. Furthermore, in the context of microbial infection, it acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2), and pseudorabies virus (PRV).

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD112 (Q32-L360)
      Accession # Q92692-2
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    NECTIN2; Poliovirus Receptor-Related 2 (Herpesvirus Entry Mediator B); Prev. PVRL2; Herpes Virus Entry Mediator B; Prev. HVEB; Herpesvirus Entry Mediator B; Nectin-2; Herpesvirus Entry Protein B; PRR2; Poliovirus Receptor-Like 2; PVRR2; CD112 Antigen; CD1

  • AA Sequence

    QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL

  • Predicted Molecular Mass

    38.4 kDa

  • Molecular Weight

    Approximately 45-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00