Neuritin Protein, Human (N-His)

Neuritin, a pivotal factor in neural development, significantly enhances neurite outgrowth and branching in hippocampal and cortical cells. Within the AMPA receptor (AMPAR) complex, Neuritin contributes to the outer core, modulating the function and properties of these receptors. The outer core, involving specific interactions with Neuritin, PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L, and NRN1, plays a crucial role in fine-tuning the gating, pharmacology, biogenesis, and protein processing of AMPARs. Neuritin's regulatory role in this protein-protein network underscores its significance in shaping AMPAR functional properties and neuronal connectivity. Neuritin Protein, Human (N-His) is the recombinant human-derived Neuritin protein, expressed by E. coli, with N-6*His labeled tag. The total length of Neuritin Protein, Human (N-His) is 88 a.a., with molecular weight of ~11 kDa.

Neuritin, a key player in neural development, significantly enhances neurite outgrowth and branching in primary hippocampal and cortical cells. Within the AMPA receptor (AMPAR) complex, Neuritin contributes to the outer core, which is part of the intricate architecture that modulates the function and properties of these receptors. The AMPAR complex, consisting of an inner core with pore-forming GluA/GRIA proteins and major auxiliary subunits, involves specific interactions with Neuritin and other components like PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L, and NRN1 in the outer core. This outer core is crucial for fine-tuning the gating, pharmacology, biogenesis, and protein processing of AMPARs. Neuritin's involvement in the complex network of protein-protein interactions highlights its role as a regulatory element in shaping the functional properties of AMPARs and underscores its significance in neuronal connectivity.

Measured in a cell proliferation assay using rat C6 cells. The ED₅₀ this effect is 17.37 ng/ml, corresponding to a specific activity is 5.76×10^4 units/mg.

• 
  Measured in a cell proliferation assay using rat C6 cells. The ED₅₀ this effect is 17.37 ng/mL, corresponding to a specific activity is 5.76×10⁴ units/mg.

Human

E. coli

N-6*His

Q9NPD7 (A28-N115)

51299  [NCBI]

AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN

Approximately 11 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.