Neuritin Protein, Human (N-His)
Based on 1 Customer Validation
Neutritin is a key factor in neural development, significantly enhancing neurite growth and branching in hippocampal and cortical cells. In the AMPA receptor (AMPAR) complex, neuronal proteins help form the outer core and regulate the function and properties of these receptors. Neuritin Protein, Human (N-His) is the recombinant human-derived Neuritin protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Neutritin is a key factor in neural development, significantly enhancing neurite growth and branching in hippocampal and cortical cells. In the AMPA receptor (AMPAR) complex, neuronal proteins help form the outer core and regulate the function and properties of these receptors. Neuritin Protein, Human (N-His) is the recombinant human-derived Neuritin protein, expressed by E. coli , with N-6*His labeled tag.
Background
Neuritin, a key player in neural development, significantly enhances neurite outgrowth and branching in primary hippocampal and cortical cells. Within the AMPA receptor (AMPAR) complex, Neuritin contributes to the outer core, which is part of the intricate architecture that modulates the function and properties of these receptors. The AMPAR complex, consisting of an inner core with pore-forming GluA/GRIA proteins and major auxiliary subunits, involves specific interactions with Neuritin and other components like PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L, and NRN1 in the outer core. This outer core is crucial for fine-tuning the gating, pharmacology, biogenesis, and protein processing of AMPARs. Neuritin's involvement in the complex network of protein-protein interactions highlights its role as a regulatory element in shaping the functional properties of AMPARs and underscores its significance in neuronal connectivity.
Verified Bioactivity
Measured in a cell proliferation assay using rat C6 cells. The ED50 this effect is < 25 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9NPD7 (A28-N115)
-
Molecular Construction
-
N-term
-
6*His
-
Neuritin (A28-N115)
Accession # Q9NPD7 -
C-term
-
-
Protein Length
Full Length of Neuritin Chain
-
Synonyms
NRN1; Neuritin; Neuritin 1; DJ380B8.2; NRN
-
AA Sequence
AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN
-
Predicted Molecular Mass
9.7 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
