NHP2L1 Protein, Human (His)

NHP2L1 is integral to ribosome biogenesis and is a key member of the small subunit (SSU) processing group, the precursor of the eukaryotic ribosomal small subunit. The SSU processing group assembles in the nucleolus and cooperates with the folding, modification, rearrangement, cleavage and targeted degradation of nascent pre-rRNA promoted by RNA exosomes. NHP2L1 Protein, Human (His) is the recombinant human-derived NHP2L1 protein, expressed by E. coli , with N-6*His labeled tag.

NHP2L1, a crucial participant in ribosome biogenesis, is an integral component of the small subunit (SSU) processome, the initial precursor of the small eukaryotic ribosomal subunit. Within the nucleolus, the SSU processome assembles, bringing together ribosome biogenesis factors, an RNA chaperone, and ribosomal proteins to collaboratively orchestrate the folding, modification, rearrangement, and cleavage of nascent pre-rRNA, alongside the targeted degradation of pre-ribosomal RNA facilitated by the RNA exosome. Additionally, NHP2L1 plays a role in pre-mRNA splicing as part of the spliceosome, where it binds to the 5'-stem-loop of U4 snRNA, contributing to spliceosome assembly. This protein undergoes a conformational change upon RNA binding and is identified in the spliceosome B complex. Furthermore, NHP2L1 is a constituent of the U4/U6-U5 tri-snRNP complex, and its interactions with RAD17 and PRPF31 highlight its multifaceted involvement in intricate cellular processes.

Human

E. coli

N-6*His

P55769 (M1-V128)

4809  [NCBI]

Full Length

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.