NHP2L1 Protein, Human (His)
NHP2L1 is integral to ribosome biogenesis and is a key member of the small subunit (SSU) processing group, the precursor of the eukaryotic ribosomal small subunit. The SSU processing group assembles in the nucleolus and cooperates with the folding, modification, rearrangement, cleavage and targeted degradation of nascent pre-rRNA promoted by RNA exosomes. NHP2L1 Protein, Human (His) is the recombinant human-derived NHP2L1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
NHP2L1 is integral to ribosome biogenesis and is a key member of the small subunit (SSU) processing group, the precursor of the eukaryotic ribosomal small subunit. The SSU processing group assembles in the nucleolus and cooperates with the folding, modification, rearrangement, cleavage and targeted degradation of nascent pre-rRNA promoted by RNA exosomes. NHP2L1 Protein, Human (His) is the recombinant human-derived NHP2L1 protein, expressed by E. coli , with N-6*His labeled tag.
NHP2L1, a crucial participant in ribosome biogenesis, is an integral component of the small subunit (SSU) processome, the initial precursor of the small eukaryotic ribosomal subunit. Within the nucleolus, the SSU processome assembles, bringing together ribosome biogenesis factors, an RNA chaperone, and ribosomal proteins to collaboratively orchestrate the folding, modification, rearrangement, and cleavage of nascent pre-rRNA, alongside the targeted degradation of pre-ribosomal RNA facilitated by the RNA exosome. Additionally, NHP2L1 plays a role in pre-mRNA splicing as part of the spliceosome, where it binds to the 5'-stem-loop of U4 snRNA, contributing to spliceosome assembly. This protein undergoes a conformational change upon RNA binding and is identified in the spliceosome B complex. Furthermore, NHP2L1 is a constituent of the U4/U6-U5 tri-snRNP complex, and its interactions with RAD17 and PRPF31 highlight its multifaceted involvement in intricate cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P55769 (M1-V128)
-
Molecular Construction
-
N-term
-
6*His
-
NHP2L1 (M1-V128)
Accession # P55769 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SNU13; OTK27; Prev. NHP2L1; NHP2 Non-Histone Chromosome Protein 2-Like 1 (S. Cerevisiae); Prev. SSFA1; Non-Histone Chromosome Protein 2 (S. Cerevisiae)-Like 1; NHP2-Like Protein 1; Small Nuclear Ribonucleoprotein 15.5kDa (U4/U6.U5); SNRNP15-5; [U4/U6.U5]
-
AA Sequence
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
-
Predicted Molecular Mass
16.3 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
