Nodal Protein, Mouse
Based on 1 Customer Validation
Nodal protein plays a key role in embryonic development and is integral for mesoderm formation and axial patterning. Its involvement in these fundamental processes underscores its importance in coordinating the complex series of events that determine early embryonic morphogenesis. Nodal Protein, Mouse is the recombinant mouse-derived Nodal protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Nodal protein plays a key role in embryonic development and is integral for mesoderm formation and axial patterning. Its involvement in these fundamental processes underscores its importance in coordinating the complex series of events that determine early embryonic morphogenesis. Nodal Protein, Mouse is the recombinant mouse-derived Nodal protein, expressed by E. coli , with tag free.
The nodal protein is a pivotal player in embryonic development, serving as a critical factor in both mesoderm formation and axial patterning. This protein functions as a homodimer, forming a robust molecular structure where two identical subunits are intricately linked through disulfide bonds. The nodal signaling pathway, mediated by this protein, is instrumental in guiding fundamental processes such as cell differentiation into the mesodermal lineage and the establishment of axial patterns in developing embryos. This regulatory role underscores the significance of the nodal protein in orchestrating the intricate dance of cellular events during embryogenesis, highlighting its essential contributions to the proper organization and development of tissues and structures in the early stages of life.
Measured by its ability to induce Smad2 phosphorylation in P19 mouse embryonal carcinoma cells. Approximately 100 ng/mL of Recombinant Mouse Nodal can effictively induce Smad2 phosphorylation.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P43021 (H245-L354)
-
Molecular Construction
-
N-term
-
Nodal (H245-L354)
Accession # P43021 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NODAL; Nodal, Mouse, Homolog; Nodal Growth Differentiation Factor; Nodal Homolog (Mouse); Nodal Homolog; HTX5
-
AA Sequence
HHLPDRSQLCRRVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLEHHKDMIVEECGCL
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 2.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
