NRBF2 Protein, Human (sf9, His-GST)

NRBF2 protein may regulate transcriptional activation through target nuclear receptors and act as a transcriptional activator in vitro. It participates in starvation-induced autophagy, binding to PI3K complex I (PI3KC3-C1) and stabilizing its assembly. NRBF2 Protein, Human (sf9, His-GST) is the recombinant human-derived NRBF2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

The NRBF2 protein is implicated in potentially modulating transcriptional activation by target nuclear receptors, acting as a transcriptional activator in vitro. It is also involved in starvation-induced autophagy, likely through its association with PI3K complex I (PI3KC3-C1), although the effects have been described variably. NRBF2 is associated with the induction of starvation-induced autophagy, stabilizing PI3KC3-C1 assembly and enhancing ATG14-linked lipid kinase activity of PIK3C3. Moreover, it is proposed to negatively regulate both basal and starvation-induced autophagy, inhibiting PIK3C3 activity by modulating interactions in PI3KC3-C1. Additionally, NRBF2 may participate in autophagosome biogenesis and play a role in the survival of neural progenitor cells during differentiation, emphasizing its multifaceted functions in cellular processes.

Human

Sf9 insect cells

N-His;N-GST

Q96F24-1 (M1-N287)

29982  [NCBI]

Full Length of Isoform-1

MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN

Approximately 61 kDa,based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.