NRBF2 Protein, Human (sf9, His-GST)
NRBF2 protein may regulate transcriptional activation through target nuclear receptors and act as a transcriptional activator in vitro. It participates in starvation-induced autophagy, binding to PI3K complex I (PI3KC3-C1) and stabilizing its assembly. NRBF2 Protein, Human (sf9, His-GST) is the recombinant human-derived NRBF2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NRBF2 protein may regulate transcriptional activation through target nuclear receptors and act as a transcriptional activator in vitro. It participates in starvation-induced autophagy, binding to PI3K complex I (PI3KC3-C1) and stabilizing its assembly. NRBF2 Protein, Human (sf9, His-GST) is the recombinant human-derived NRBF2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
The NRBF2 protein is implicated in potentially modulating transcriptional activation by target nuclear receptors, acting as a transcriptional activator in vitro. It is also involved in starvation-induced autophagy, likely through its association with PI3K complex I (PI3KC3-C1), although the effects have been described variably. NRBF2 is associated with the induction of starvation-induced autophagy, stabilizing PI3KC3-C1 assembly and enhancing ATG14-linked lipid kinase activity of PIK3C3. Moreover, it is proposed to negatively regulate both basal and starvation-induced autophagy, inhibiting PIK3C3 activity by modulating interactions in PI3KC3-C1. Additionally, NRBF2 may participate in autophagosome biogenesis and play a role in the survival of neural progenitor cells during differentiation, emphasizing its multifaceted functions in cellular processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
Q96F24-1 (M1-N287)
-
Molecular Construction
-
N-term
-
His-GST
-
NRBF2 (M1-N287)
Accession # Q96F24-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
NRBF2; Comodulator Of PPAR And RXR 2; Nuclear Receptor Binding Factor 2; DKFZp564C1664; COPR1; FLJ30395; COPR2; NRBF-2; Nuclear Receptor-Binding Factor 2; COPR; Comodulator Of PPAR And RXR 1; Comodulator Of PPAR And RXR
-
AA Sequence
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN
-
Predicted Molecular Mass
60.2 kDa
-
Molecular Weight
Approximately 61 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
