1. Recombinant Proteins
  2. Others
  3. NRBF2 Protein, Human (sf9, His-GST)

NRBF2 protein may regulate transcriptional activation through target nuclear receptors and act as a transcriptional activator in vitro. It participates in starvation-induced autophagy, binding to PI3K complex I (PI3KC3-C1) and stabilizing its assembly. NRBF2 Protein, Human (sf9, His-GST) is the recombinant human-derived NRBF2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NRBF2 protein may regulate transcriptional activation through target nuclear receptors and act as a transcriptional activator in vitro. It participates in starvation-induced autophagy, binding to PI3K complex I (PI3KC3-C1) and stabilizing its assembly. NRBF2 Protein, Human (sf9, His-GST) is the recombinant human-derived NRBF2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

The NRBF2 protein is implicated in potentially modulating transcriptional activation by target nuclear receptors, acting as a transcriptional activator in vitro. It is also involved in starvation-induced autophagy, likely through its association with PI3K complex I (PI3KC3-C1), although the effects have been described variably. NRBF2 is associated with the induction of starvation-induced autophagy, stabilizing PI3KC3-C1 assembly and enhancing ATG14-linked lipid kinase activity of PIK3C3. Moreover, it is proposed to negatively regulate both basal and starvation-induced autophagy, inhibiting PIK3C3 activity by modulating interactions in PI3KC3-C1. Additionally, NRBF2 may participate in autophagosome biogenesis and play a role in the survival of neural progenitor cells during differentiation, emphasizing its multifaceted functions in cellular processes.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

Q96F24-1 (M1-N287)

Gene ID
Molecular Construction
N-term
His-GST
NRBF2 (M1-N287)
Accession # Q96F24-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Nuclear receptor-binding factor 2; Comodulator of PPAR and RXR; COPR
AA Sequence

MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN

Predicted Molecular Mass
60.2 kDa
Molecular Weight

Approximately 61 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NRBF2 Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NRBF2 Protein, Human (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NRBF2 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P76523
Quantity:
MCE Japan Authorized Agent: