1. Recombinant Proteins
  2. Viral Proteins Others
  3. SARS-CoV-2 NSP3 Protein (183a.a)

The multifunctional PL-PRO protein plays a critical role in viral RNA transcription and replication, providing the necessary proteases for multiprotein cleavage. It strategically blocks host translation by binding to the open head conformation of the 40S subunit, impeding ribosomal mRNA entry into the tunnel. NSP3 Protein, SARS-CoV-2 (A1-T183) is the recombinant virus-derived NSP3, expressed by E. coli, with tag-free.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The multifunctional PL-PRO protein plays a critical role in viral RNA transcription and replication, providing the necessary proteases for multiprotein cleavage. It strategically blocks host translation by binding to the open head conformation of the 40S subunit, impeding ribosomal mRNA entry into the tunnel. NSP3 Protein, SARS-CoV-2 (A1-T183) is the recombinant virus-derived NSP3, expressed by E. coli, with tag-free.

Background

nsp3 (papain-like protease) is a key functional protein in the viral replicase polyprotein, mainly responsible for the cleavage of the N-terminus of the replicase polyprotein; it participates in the assembly of virus-induced cytoplasmic double-membrane vesicles (DMVs) together with nsp4 (DMVs are necessary for viral replication) and plays a role in its formation and maintenance (DMVs are formed by nsp3 and nsp4, and nsp6 is involved in the connection of the endoplasmic reticulum membrane and the binding to lipid droplets). At the same time, nsp3 inhibits the induction of type I interferon by blocking the phosphorylation, dimerization and nuclear translocation of host IRF3, and can also inhibit NF-κB signaling, thereby antagonizing innate immunity. In addition, it has deubiquitination/de-ISG activity, can process Lys-48 and Lys-63-linked polyubiquitin chains in cellular substrates, preferentially cuts ISG15 from the antiviral protein IFIH1 (MDA5) (has no effect on RIGI), and participates in the host ADP-ribosylation process.

Species

Virus

Source

E. coli

Tag

Tag Free

Accession

P0DTC1-1 (A819-T1001)

Gene ID

43740578

Protein Length

Partial

Synonyms
Replicase polyprotein 1a; ORF1a polyprotein; Severe acute respiratory syndrome coronavirus 2; 2019-nCoV; pp1a; Endonuclease; Hydrolase; Methyltransferase; Nuclease; Protease; RNA-binding; Thiol protease; Transferase
AA Sequence

APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTT

Predicted Molecular Mass
20.7 kDa
Pureza

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación

SARS-CoV-2 NSP3 Protein (183a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

SARS-CoV-2 NSP3 Protein (183a.a)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
SARS-CoV-2 NSP3 Protein (183a.a)
Cat. No.:
HY-P703535
Cantidad:
MCE Japan Authorized Agent: