Nucleocapsid Protein CTD domain, Virus (His-Avi)
SARS-CoV-2 S1 Protein, in its Spike protein S1 form, initiates infection by attaching the virion to the cell membrane through host receptor interaction. Simultaneously, Spike protein S2' acts as a viral fusion peptide, revealing itself after S2 cleavage during virus endocytosis. Nucleocapsid Protein CTD domain, Virus (His-Avi) is the recombinant Virus-derived Nucleocapsid protein CTD domain, Virus, expressed by E. coli , with N-His, N-Avi labeled tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
SARS-CoV-2 S1 Protein, in its Spike protein S1 form, initiates infection by attaching the virion to the cell membrane through host receptor interaction. Simultaneously, Spike protein S2' acts as a viral fusion peptide, revealing itself after S2 cleavage during virus endocytosis. Nucleocapsid Protein CTD domain, Virus (His-Avi) is the recombinant Virus-derived Nucleocapsid protein CTD domain, Virus, expressed by E. coli , with N-His, N-Avi labeled tag.
Background
The SARS-CoV-2 S1 Protein plays a crucial role in the early stages of viral infection. Spike protein S1 facilitates the attachment of the virion to the cell membrane by interacting with host receptors, thereby initiating the infection process. This initial binding event is pivotal for the subsequent entry of the virus into the host cell. Concurrently, Spike protein S2', serving as a viral fusion peptide, comes into play after S2 cleavage during virus endocytosis. The unmasking of S2' is a key step in the viral fusion process, enabling the merging of the viral membrane with the endosomal membrane and facilitating the release of the viral genetic material into the host cell cytoplasm. The concerted action of these S1 and S2' functionalities underscores the significance of the SARS-CoV-2 S1 Protein in mediating viral entry and fusion, crucial steps in the viral life cycle.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag N-Avi;N-6*His
-
Accession
QHD43423.2 (G243-P364)
-
Molecular Construction
-
N-term
-
6*His-Avi
-
Nucleocapsid CTD (G243-P364)
Accession # P0DTC2/QHD43423.2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Nucleocapsid; NP; NC
-
AA Sequence
GQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP
-
Predicted Molecular Mass
17 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)