Oncomodulin-1 Protein, Human (His)
Based on 1 Customer Validation
Oncomodulin-1 protein, exhibiting calmodulin-like activity, activates enzymes and regulates growth, binding two calcium ions and participating in calcium-mediated cellular processes. Oncomodulin-1 Protein, Human (His) is the recombinant human-derived Oncomodulin-1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Oncomodulin-1 protein, exhibiting calmodulin-like activity, activates enzymes and regulates growth, binding two calcium ions and participating in calcium-mediated cellular processes. Oncomodulin-1 Protein, Human (His) is the recombinant human-derived Oncomodulin-1 protein, expressed by E. coli , with N-6*His labeled tag.
The Oncomodulin-1 protein displays calmodulin-like activity, particularly in terms of enzyme activation and growth regulation. It is capable of binding two calcium ions, indicating its involvement in calcium-mediated cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P0CE72 (M1-S109)
-
Molecular Construction
-
N-term
-
6*His
-
Oncomodulin-1 (M1-S109)
Accession # P0CE72 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
OCM; OM; Oncomodulin; Oncomodulin 1; OCM1; HCG18255; Beta Parvalbumin; ONCM; Parvalbumin Beta; OCMN; Oncomodulin-1
-
AA Sequence
MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS
-
Predicted Molecular Mass
14.3 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
