2. Recombinant Proteins
  3. Others
  4. Otoraplin/OTOR Protein, Human (CHO)

Otoraplin/OTOR Protein, Human (CHO)

Cat. No.: HY-P7393
COA Handling Instructions

Otoraplin/OTOR Protein, Human (CHO) is a protein encoded by OTOR gene, is homologous to the protein encoded by CDRAP/MIA, and may acts in cartilage development and maintenance.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock
10 μg $160 Ask For Quote & Lead Time
50 μg $320 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Otoraplin/OTOR Protein, Human (CHO) is a protein encoded by OTOR gene, is homologous to the protein encoded by CDRAP/MIA, and may acts in cartilage development and maintenance.
Background

Human Otoraplin is a protein encoded by OTOR gene, is homologous to the protein encoded by CDRAP/MIA, and may acts in cartilage development and maintenance[1].
Species

Human
Source

CHO
Tag

Tag Free
Accession

Q9NRC9 (V18-E128)
Gene ID
Molecular Construction
N-term
Otoraplin (V18-E128)
Accession # Q9NRC9
C-term
Synonyms
rHuOTOR; Fibrocyte-derived protein; Melanoma inhibitory activity-like protein; OTOR; MIAL
AA Sequence

VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE

Molecular Weight

14-15 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<0.2 EU/μg, determined by LAL method.
Documentation

COA (219 KB)

Handling Instructions (2659 KB)
References

Otoraplin/OTOR Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Otoraplin/OTOR Protein, Human (CHO)
Cat. No.:
HY-P7393
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.