p24 Protein, HIV-1 (His)
p24 Protein, HIV-1 (His) is the recombinant virus-derived p24 , HIV-1 protein, expressed by E. coli, with C-6*His tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
p24 Protein, HIV-1 (His) is the recombinant virus-derived p24 , HIV-1 protein, expressed by E. coli, with C-6*His tag.
Background
HIV-1 p24, the core capsid protein of HIV-1, collaborates with Gag-Pol polyprotein to mediate essential steps in virion assembly. Its functions include: binding the plasma membrane, facilitating protein-protein interactions for spherical particle formation, recruiting viral Env proteins, and packaging genomic RNA via direct interaction with the Psi RNA packaging sequence. by similar: p24 belongs to the Gag protein family and serves as a core structural component for viral assembly.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag C-6*His
-
Accession
P12493 (M142-G355)
-
Gene ID/
-
Protein Length
Partial
-
Synonyms
Gag polyprotein; Pr55Gag; Matrix protein p17; MA; Capsid protein p24; CA; Spacer peptide 1; SP1; p2; Nucleocapsid protein p7; NC; Spacer peptide 2; SP2
-
AA Sequence
MVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGG
-
Predicted Molecular Mass
24.6 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
