p24 Protein, HIV-1 (His)

p24 Protein, HIV-1 (His) is the recombinant virus-derived p24 , HIV-1 protein, expressed by E. coli, with C-6*His tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

p24 Protein, HIV-1 (His) is the recombinant virus-derived p24 , HIV-1 protein, expressed by E. coli, with C-6*His tag.

Background

HIV-1 p24, the core capsid protein of HIV-1, collaborates with Gag-Pol polyprotein to mediate essential steps in virion assembly. Its functions include: binding the plasma membrane, facilitating protein-protein interactions for spherical particle formation, recruiting viral Env proteins, and packaging genomic RNA via direct interaction with the Psi RNA packaging sequence. by similar: p24 belongs to the Gag protein family and serves as a core structural component for viral assembly.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    Gag polyprotein; Pr55Gag; Matrix protein p17; MA; Capsid protein p24; CA; Spacer peptide 1; SP1; p2; Nucleocapsid protein p7; NC; Spacer peptide 2; SP2

  • AA Sequence

    MVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGG

  • Predicted Molecular Mass

    24.6 kDa

  • Molecular Weight

    Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00