Copy Link Print Information

PAEP Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

PAEP protein is a glycoprotein that regulates fertilization steps and exhibits immunomodulatory effects. PAEP Protein, Human (HEK293, His) is the recombinant human-derived PAEP protein, expressed by HEK293 , with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for PAEP Protein, Human (HEK293, His)
  • PAEP Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PAEP protein is a glycoprotein that regulates fertilization steps and exhibits immunomodulatory effects. PAEP Protein, Human (HEK293, His) is the recombinant human-derived PAEP protein, expressed by HEK293 , with N-10*His labeled tag.

Background

The PAEP Protein, a glycoprotein, intricately regulates crucial steps during fertilization while also exerting immunomodulatory effects. In reproductive tissues, four distinct glycoforms—namely glycodelin-S, -A, -F, and -C—have been identified, each characterized by unique glycosylation patterns and biological activities. Glycodelin-A, for instance, exhibits both contraceptive and immunosuppressive activities. On the other hand, Glycodelin-C plays a role in stimulating the binding of spermatozoa to the zona pellucida. In contrast, Glycodelin-F serves to inhibit spermatozoa-zona pellucida binding and significantly suppresses the progesterone-induced acrosome reaction of spermatozoa. Additionally, Glycodelin-S, present in seminal plasma, maintains the uncapacitated state of human spermatozoa. The protein forms a homodimer, further emphasizing its structural complexity and functional diversity in orchestrating key events during fertilization and modulating immune responses.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-10*His
  • Accession

    P09466-1 (M19-F180)

  • Gene ID
    5047  [NCBI]
  • Molecular Construction
    • N-term
    • 10*His
    • PAEP (M19-F180)
      Accession # P09466-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PAEP; PP14 Protein (Placental Protein 14); Progestagen Associated Endometrial Protein; Zona-Binding Inhibitory Factor-1; Glycodelin; Alpha Uterine Protein; PP14; Placental Protein 14; PAEG; Glycodelin-A; GD; Glycodelin-S; Progesterone-Associated Endometri

  • AA Sequence

    MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

  • Predicted Molecular Mass

    20.2 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 30% glycerin, pH 8.0.
2.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
3.Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCL, 150 mM NaCl, pH 8.0, 30% glycerol.
Note:For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • PAEP Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for PAEP Protein, Human (HEK293, His)
  • PAEP Protein, Human (HEK293, His) Product Image