1. Recombinant Proteins
  2. Others
  3. PAR2 Protein, Human (sf9, Flag, His)

PAR2 Protein, Human (sf9, Flag, His) is the recombinant human-derived PAR2, expressed by sf9 insect cells , with His, Flag labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PAR2 Protein, Human (sf9, Flag, His) is the recombinant human-derived PAR2, expressed by sf9 insect cells , with His, Flag labeled tag. ,

Background

PAR2 is a G protein-coupled receptor for trypsin and trypsin-like enzymes, functioning through activation of pathways including PLC, intracellular calcium, MAPK, NF-kappaB, and Rho. It can be transactivated by cleaved PAR1 and modulates inflammatory responses, immunity, and acts as a sensor for infection-related proteases, generally promoting inflammation. PAR2 synergizes with TLR4/TLR2 in inflammation and regulates TLR3 signaling. It protects endothelial barrier integrity (involving factor X) and regulates neutrophil extravasation (potentially via PRTN3 cleavage). In airways, it exhibits both bronchoprotective and barrier-disrupting effects (via E-cadherin interruption). PAR2 mediates hypotension through vasodilation and associates with GNAQ/GNA11 but not certain G(i) subunits (though G(i)-alpha signaling was reported). As a class B receptor, it internalizes with arrestin. It inhibits TNF-α-induced JNK phosphorylation via GNAQ/GNA11 and mediates RELA Ser-536 phosphorylation (largely G protein-independent). PAR2 drives migration/chemotaxis via β-arrestin scaffolds and recruits leukocytes to inflammation sites. It enhances phagocytosis, bacterial killing, and antiviral responses, implicated in inflammatory/autoimmune diseases. By similarity: proposed to mediate pro-inflammatory/fibrotic fibroblast responses triggered by factor Xa; demonstrated function (PubMed:22409427): mediates endothelial barrier-protective signaling via factor Xa.

Species

Human

Source

Sf9 insect cells

Tag

His;Flag

Accession

P55085 (V55-L269, E276-K377, G89A, H108A, G157A, M166L, Y174A, V176E, N222Q, M268A, I289A, L293A)

Gene ID

2150

Protein Length

Partial

Synonyms
GPR11; PAR2
AA Sequence

ENSEKKRKRAIKLAVTVAAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSK

Predicted Molecular Mass
49.8 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM HEPES, pH 7.5, 150 mM NaCl, 0.01%, w/v LMNG, 0.002%, w/v CHS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PAR2 Protein, Human (sf9, Flag, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PAR2 Protein, Human (sf9, Flag, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PAR2 Protein, Human (sf9, Flag, His)
Cat. No.:
HY-P703125
Quantity:
MCE Japan Authorized Agent: