PAR2 Protein, Human (sf9, Flag, His)

PAR2 Protein, Human (sf9, Flag, His) is the recombinant human-derived PAR2, expressed by sf9 insect cells , with His, Flag labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PAR2 Protein, Human (sf9, Flag, His) is the recombinant human-derived PAR2, expressed by sf9 insect cells , with His, Flag labeled tag. ,

Background

PAR2 is a G protein-coupled receptor for trypsin and trypsin-like enzymes, functioning through activation of pathways including PLC, intracellular calcium, MAPK, NF-kappaB, and Rho. It can be transactivated by cleaved PAR1 and modulates inflammatory responses, immunity, and acts as a sensor for infection-related proteases, generally promoting inflammation. PAR2 synergizes with TLR4/TLR2 in inflammation and regulates TLR3 signaling. It protects endothelial barrier integrity (involving factor X) and regulates neutrophil extravasation (potentially via PRTN3 cleavage). In airways, it exhibits both bronchoprotective and barrier-disrupting effects (via E-cadherin interruption). PAR2 mediates hypotension through vasodilation and associates with GNAQ/GNA11 but not certain G(i) subunits (though G(i)-alpha signaling was reported). As a class B receptor, it internalizes with arrestin. It inhibits TNF-α-induced JNK phosphorylation via GNAQ/GNA11 and mediates RELA Ser-536 phosphorylation (largely G protein-independent). PAR2 drives migration/chemotaxis via β-arrestin scaffolds and recruits leukocytes to inflammation sites. It enhances phagocytosis, bacterial killing, and antiviral responses, implicated in inflammatory/autoimmune diseases. By similarity: proposed to mediate pro-inflammatory/fibrotic fibroblast responses triggered by factor Xa; demonstrated function (PubMed:22409427): mediates endothelial barrier-protective signaling via factor Xa.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag His;Flag
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    F2RL1; G-Protein Coupled Receptor 11; Prev. GPR11; Coagulation Factor II Receptor-Like 1; PAR2; Proteinase-Activated Receptor-2; Coagulation Factor II (Thrombin) Receptor-Like 1; Protease-Activated Receptor 2; Proteinase-Activated Receptor 2; PAR-2; F2R L

  • AA Sequence

    ENSEKKRKRAIKLAVTVAAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSK

  • Predicted Molecular Mass

    49.8 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00