PBK/TOPK Protein, Human (sf9, His)
Based on 1 Customer Validation
PBK/TOPK Protein, a mitosis-specific kinase, phosphorylates MAP kinase p38, emphasizing its specific role in cell division. Implicated in lymphoid cell activation, PBK/TOPK has broader impacts on immune responses. When phosphorylated, it forms a complex with TP53, destabilizing TP53 and dampening the G2/M checkpoint in doxorubicin-induced DNA damage, highlighting its multifaceted functions in cell cycle control and genotoxic stress responses. PBK/TOPK Protein, Human (sf9, His) is the recombinant human-derived PBK/TOPK protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PBK/TOPK Protein, a mitosis-specific kinase, phosphorylates MAP kinase p38, emphasizing its specific role in cell division. Implicated in lymphoid cell activation, PBK/TOPK has broader impacts on immune responses. When phosphorylated, it forms a complex with TP53, destabilizing TP53 and dampening the G2/M checkpoint in doxorubicin-induced DNA damage, highlighting its multifaceted functions in cell cycle control and genotoxic stress responses. PBK/TOPK Protein, Human (sf9, His) is the recombinant human-derived PBK/TOPK protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
PBK/TOPK, a mitosis-specific protein kinase, exhibits activity by phosphorylating MAP kinase p38. Its functional involvement appears to be confined to mitotic processes, emphasizing a specific role during cell division. Additionally, PBK/TOPK is implicated in the activation of lymphoid cells, suggesting a broader impact on immune responses. Notably, when phosphorylated, PBK/TOPK forms a complex with TP53, resulting in TP53 destabilization and a dampening of the G2/M checkpoint in response to DNA damage induced by doxorubicin. This intricate regulation underscores the multifaceted functions of PBK/TOPK in cell cycle control and cellular responses to genotoxic stress.
Verified Bioactivity
The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q96KB5-1 (M1-V322)
-
Molecular Construction
-
N-term
-
PBK (M1-V322)
Accession # Q96KB5-1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PBK; Lymphokine-Activated Killer T-Cell-Originated Protein Kinase; PDZ Binding Kinase; Spermatogenesis-Related Protein Kinase; Nori-3; Epididymis Luminal Protein 164; TOPK; MAPKK-Like Protein Kinase; CT84; FLJ14385; SPK; Serine/Threonine Protein Kinase; T
-
AA Sequence
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
-
Predicted Molecular Mass
37.6 kDa
-
Molecular Weight
Approximately 38-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
