1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins Other Kinases
  4. TOPK
  5. PBK
  6. PBK/TOPK Protein, Human (sf9, His)

PBK/TOPK Protein, a mitosis-specific kinase, phosphorylates MAP kinase p38, emphasizing its specific role in cell division. Implicated in lymphoid cell activation, PBK/TOPK has broader impacts on immune responses. When phosphorylated, it forms a complex with TP53, destabilizing TP53 and dampening the G2/M checkpoint in doxorubicin-induced DNA damage, highlighting its multifaceted functions in cell cycle control and genotoxic stress responses. PBK/TOPK Protein, Human (sf9, His) is the recombinant human-derived PBK/TOPK protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PBK/TOPK Protein, a mitosis-specific kinase, phosphorylates MAP kinase p38, emphasizing its specific role in cell division. Implicated in lymphoid cell activation, PBK/TOPK has broader impacts on immune responses. When phosphorylated, it forms a complex with TP53, destabilizing TP53 and dampening the G2/M checkpoint in doxorubicin-induced DNA damage, highlighting its multifaceted functions in cell cycle control and genotoxic stress responses. PBK/TOPK Protein, Human (sf9, His) is the recombinant human-derived PBK/TOPK protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

PBK/TOPK, a mitosis-specific protein kinase, exhibits activity by phosphorylating MAP kinase p38. Its functional involvement appears to be confined to mitotic processes, emphasizing a specific role during cell division. Additionally, PBK/TOPK is implicated in the activation of lymphoid cells, suggesting a broader impact on immune responses. Notably, when phosphorylated, PBK/TOPK forms a complex with TP53, resulting in TP53 destabilization and a dampening of the G2/M checkpoint in response to DNA damage induced by doxorubicin. This intricate regulation underscores the multifaceted functions of PBK/TOPK in cell cycle control and cellular responses to genotoxic stress.

Biological Activity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q96KB5-1 (M1-V322)

Gene ID
Molecular Construction
N-term
PBK (M1-V322)
Accession # Q96KB5-1
His
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Lymphokine-activated killer T-cell-originated protein kinase; CT84; Nori-3; SPK; TOPK
AA Sequence

MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV

Molecular Weight

35-45 kDa

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PBK/TOPK Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PBK/TOPK Protein, Human (sf9, His)
Cat. No.:
HY-P77122
Quantity:
MCE Japan Authorized Agent: