PBP1A Protein, Mycobacterium tuberculosis (His)
PBP1A (penicillin-binding protein 1A) is involved in cell wall formation and plays a crucial role in the synthesis of cross-linked peptidoglycan from lipid intermediates. The enzyme has a bifunctional structure. The penicillin-insensitive transglycosylase N-terminal domain is responsible for the formation of linear glycan chains, and the penicillin-sensitive transpeptidase C-terminal domain promotes the cross-linking of peptide subunits. PBP1A Protein, Mycobacterium tuberculosis (His) is the recombinant PBP1A protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PBP1A (penicillin-binding protein 1A) is involved in cell wall formation and plays a crucial role in the synthesis of cross-linked peptidoglycan from lipid intermediates. The enzyme has a bifunctional structure. The penicillin-insensitive transglycosylase N-terminal domain is responsible for the formation of linear glycan chains, and the penicillin-sensitive transpeptidase C-terminal domain promotes the cross-linking of peptide subunits. PBP1A Protein, Mycobacterium tuberculosis (His) is the recombinant PBP1A protein, expressed by E. coli , with N-6*His labeled tag.
Background
PBP1A (Penicillin-Binding Protein 1A) is a crucial enzyme involved in cell wall formation in bacteria, specifically in the synthesis of cross-linked peptidoglycan from lipid intermediates. The protein exhibits a bifunctional structure with a penicillin-insensitive transglycosylase N-terminal domain responsible for the formation of linear glycan strands, and a penicillin-sensitive transpeptidase C-terminal domain that facilitates the cross-linking of peptide subunits. While PBP1A has limited peptidoglycan hydrolytic activity on its own, it plays a notable role in inhibiting the synergistic peptidoglycan hydrolysis of RipA plus RpfB.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
P71707 (K391-P820)
-
Gene ID887065
-
Molecular Construction
-
N-term
-
6*His
-
PBP1A (K391-P820)
Accession # P71707 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Penicillin-binding protein A1; PBP-A1; Penicillin-binding protein 1*; PBP1*; Penicillin-binding protein PonA1; Penicillin-insensitive transglycosylase; EC:2.4.99.28; Peptidoglycan Tgase; Penicillin-sensitive transpeptidase; EC:3.4.16.4; DD-transpeptidase;
-
AA Sequence
KGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPPPPPEVPPSETVIQPTVEIAPGITIPIGPPTTITLAPPPPAPPAATPTPPP
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)