1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. PBP1A Protein, Mycobacterium tuberculosis

PBP1A (penicillin-binding protein 1A) is involved in cell wall formation and plays a crucial role in the synthesis of cross-linked peptidoglycan from lipid intermediates. The enzyme has a bifunctional structure. The penicillin-insensitive transglycosylase N-terminal domain is responsible for the formation of linear glycan chains, and the penicillin-sensitive transpeptidase C-terminal domain promotes the cross-linking of peptide subunits. PBP1A Protein, Mycobacterium tuberculosis is the recombinant PBP1A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PBP1A (penicillin-binding protein 1A) is involved in cell wall formation and plays a crucial role in the synthesis of cross-linked peptidoglycan from lipid intermediates. The enzyme has a bifunctional structure. The penicillin-insensitive transglycosylase N-terminal domain is responsible for the formation of linear glycan chains, and the penicillin-sensitive transpeptidase C-terminal domain promotes the cross-linking of peptide subunits. PBP1A Protein, Mycobacterium tuberculosis is the recombinant PBP1A protein, expressed by E. coli , with tag free.

Background

PBP1A (Penicillin-Binding Protein 1A) is a crucial enzyme involved in cell wall formation in bacteria, specifically in the synthesis of cross-linked peptidoglycan from lipid intermediates. The protein exhibits a bifunctional structure with a penicillin-insensitive transglycosylase N-terminal domain responsible for the formation of linear glycan strands, and a penicillin-sensitive transpeptidase C-terminal domain that facilitates the cross-linking of peptide subunits. While PBP1A has limited peptidoglycan hydrolytic activity on its own, it plays a notable role in inhibiting the synergistic peptidoglycan hydrolysis of RipA plus RpfB.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

P71707 (K391-P820)

Gene ID

887065

Molecular Construction
N-term
PBP1A (K391-P820)
Accession # P71707
C-term
Protein Length

Partial

Synonyms
ponA1; Penicillin-binding protein 1A; PBP-1A; Penicillin-binding protein 1*; Penicillin-insensitive transglycosylase; Peptidoglycan TGase; Penicillin-sensitive transpeptidase; DD-transpeptidase
AA Sequence

KGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPPPPPEVPPSETVIQPTVEIAPGITIPIGPPTTITLAPPPPAPPAATPTPPP

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PBP1A Protein, Mycobacterium tuberculosis Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PBP1A Protein, Mycobacterium tuberculosis

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PBP1A Protein, Mycobacterium tuberculosis
Cat. No.:
HY-P701958
Quantity:
MCE Japan Authorized Agent: