PBP1A Protein, Mycobacterium tuberculosis

PBP1A (penicillin-binding protein 1A) is involved in cell wall formation and plays a crucial role in the synthesis of cross-linked peptidoglycan from lipid intermediates. The enzyme has a bifunctional structure. The penicillin-insensitive transglycosylase N-terminal domain is responsible for the formation of linear glycan chains, and the penicillin-sensitive transpeptidase C-terminal domain promotes the cross-linking of peptide subunits. PBP1A Protein, Mycobacterium tuberculosis is the recombinant PBP1A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PBP1A (penicillin-binding protein 1A) is involved in cell wall formation and plays a crucial role in the synthesis of cross-linked peptidoglycan from lipid intermediates. The enzyme has a bifunctional structure. The penicillin-insensitive transglycosylase N-terminal domain is responsible for the formation of linear glycan chains, and the penicillin-sensitive transpeptidase C-terminal domain promotes the cross-linking of peptide subunits. PBP1A Protein, Mycobacterium tuberculosis is the recombinant PBP1A protein, expressed by E. coli , with tag free.

Background

PBP1A (Penicillin-Binding Protein 1A) is a crucial enzyme involved in cell wall formation in bacteria, specifically in the synthesis of cross-linked peptidoglycan from lipid intermediates. The protein exhibits a bifunctional structure with a penicillin-insensitive transglycosylase N-terminal domain responsible for the formation of linear glycan strands, and a penicillin-sensitive transpeptidase C-terminal domain that facilitates the cross-linking of peptide subunits. While PBP1A has limited peptidoglycan hydrolytic activity on its own, it plays a notable role in inhibiting the synergistic peptidoglycan hydrolysis of RipA plus RpfB.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PBP1A (K391-P820)
      Accession # P71707
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Penicillin-binding protein A1; PBP-A1; Penicillin-binding protein 1*; PBP1*; Penicillin-binding protein PonA1; Penicillin-insensitive transglycosylase; EC:2.4.99.28; Peptidoglycan Tgase; Penicillin-sensitive transpeptidase; EC:3.4.16.4; DD-transpeptidase;

  • AA Sequence

    KGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPPPPPEVPPSETVIQPTVEIAPGITIPIGPPTTITLAPPPPAPPAATPTPPP

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00