PCDH7 Protein, Human (sf9, His)
PCDH7 Protein, an integral membrane protein, belongs to the PCDHδ1 subfamily and it is highly expressed in brain and heart. PCDH7 is a synaptically localized, GluN1-interacting protein that regulates synapse morphology and function. PCDH7 is the first trans-membrane protein that inhibits homotypic cell-in-cell (hoCIC) formation to promote tumor growth. PCDH7 Protein, Human (sf9, His) is the recombinant human-derived PCDH7 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PCDH7 Protein, an integral membrane protein, belongs to the PCDHδ1 subfamily and it is highly expressed in brain and heart. PCDH7 is a synaptically localized, GluN1-interacting protein that regulates synapse morphology and function. PCDH7 is the first trans-membrane protein that inhibits homotypic cell-in-cell (hoCIC) formation to promote tumor growth[1][2]. PCDH7 Protein, Human (sf9, His) is the recombinant human-derived PCDH7 protein, expressed by Sf9 insect cells , with N-His labeled tag.
PCDH7 as the first trans-membrane protein that inhibits hoCIC formation to promote tumor growth. PCDH7 overexpression reduces synaptic NMDA receptor currents. PCDH7 can regulate dendritic spine morphology and synaptic function. PCDH7 is highly expressed in the brain and has been linked to CNS disorders, including epilepsy. PCDH7 increases the level of pMLC2 leading to enhanced actomyosin at the intercellular region and compromised hoCIC formation[2].
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
O60245-1/NP_002580.2 (A29-S879)
-
Molecular Construction
-
N-term
-
His
-
PCDH7 (A29-S879)
Accession # O60245-1/NP_002580.2 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PCDH7; BH-Protocadherin (Brain-Heart); Protocadherin 7; Brain-Heart Protocadherin; BH-Pcdh; Protocadherin-7; PPP1R120; BHPCDH; Protein Phosphatase 1, Regulatory Subunit 120
-
AA Sequence
AAKQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELLQEPGGGGSGGESRRAGAADSAPYPGGGGNGASGGGSGGSKRRLDASEGGGGTNPGGRSSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAATESVRRLLRLDETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKIGRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTSTPLDYEATREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPMFGQSVVEVYFPENNIPGERVATVLATDADSGKNAEIAYSLDSSVMGIFAIDPDSGDILVNTVLDREQTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTLPKNISYTLLPPSSNVRTVVATVLATDSDDGINADLNYSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVNESVSNATAIDSQIARSLHIPLTQDIAGDPSYEISKQRLS
-
Predicted Molecular Mass
94 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
