1. Recombinant Proteins
  2. Others
  3. PCDH7 Protein, Human (sf9, His)

PCDH7 Protein, an integral membrane protein, belongs to the PCDHδ1 subfamily and it is highly expressed in brain and heart. PCDH7 is a synaptically localized, GluN1-interacting protein that regulates synapse morphology and function. PCDH7 is the first trans-membrane protein that inhibits homotypic cell-in-cell (hoCIC) formation to promote tumor growth. PCDH7 Protein, Human (sf9, His) is the recombinant human-derived PCDH7 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

PCDH7 Protein, an integral membrane protein, belongs to the PCDHδ1 subfamily and it is highly expressed in brain and heart. PCDH7 is a synaptically localized, GluN1-interacting protein that regulates synapse morphology and function. PCDH7 is the first trans-membrane protein that inhibits homotypic cell-in-cell (hoCIC) formation to promote tumor growth[1][2]. PCDH7 Protein, Human (sf9, His) is the recombinant human-derived PCDH7 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

PCDH7 as the first trans-membrane protein that inhibits hoCIC formation to promote tumor growth. PCDH7 overexpression reduces synaptic NMDA receptor currents. PCDH7 can regulate dendritic spine morphology and synaptic function. PCDH7 is highly expressed in the brain and has been linked to CNS disorders, including epilepsy. PCDH7 increases the level of pMLC2 leading to enhanced actomyosin at the intercellular region and compromised hoCIC formation[2].

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

O60245-1/NP_002580.2 (A29-S879)

Gene ID
Molecular Construction
N-term
His
PCDH7 (A29-S879)
Accession # O60245-1/NP_002580.2
C-term
Protein Length

Extracellular Domain

Synonyms
Protocadherin-7; Brain-heart protocadherin; BH-Pcdh; PCDH7; BHPCDH
AA Sequence

AAKQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELLQEPGGGGSGGESRRAGAADSAPYPGGGGNGASGGGSGGSKRRLDASEGGGGTNPGGRSSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAATESVRRLLRLDETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKIGRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTSTPLDYEATREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPMFGQSVVEVYFPENNIPGERVATVLATDADSGKNAEIAYSLDSSVMGIFAIDPDSGDILVNTVLDREQTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTLPKNISYTLLPPSSNVRTVVATVLATDSDDGINADLNYSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVNESVSNATAIDSQIARSLHIPLTQDIAGDPSYEISKQRLS

Predicted Molecular Mass
94 kDa
Glycosylation
Yes
Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación

PCDH7 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

PCDH7 Protein, Human (sf9, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
PCDH7 Protein, Human (sf9, His)
Cat. No.:
HY-P75956
Cantidad:
MCE Japan Authorized Agent: