PDGF-BB Protein, Mouse (C-His)

Customer Review

Based on 1 Customer Validation

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (C-His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (C-His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

Background

The PDGF-BB Protein is a pivotal member of the PDGF/VEGF growth factor family, indicating its crucial role in cellular signaling and tissue development. As part of this growth factor family, PDGF-BB likely shares conserved structural and functional characteristics with related proteins, contributing to cell growth, angiogenesis, and vascular development. Its membership in the PDGF/VEGF growth factor family highlights its significance in orchestrating essential physiological processes necessary for tissue homeostasis. The study of PDGF-BB provides insights into its specific functions within the context of the growth factor family, offering potential applications in therapeutic interventions and a deeper understanding of its broader impact on cellular processes involved in vascular development and maintenance. Further exploration of PDGF-BB's role promises to enhance our comprehension of its contributions to normal physiology and pathological conditions.

Verified Bioactivity

Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 1.77 ng/mL, corresponding to a specific activity is 5.65×10^5 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PDGF-BB (S82-T190)
      Accession # P31240
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PDGFB; Platelet-Derived Growth Factor 2; Prev. SIS; PDGF Subunit B; Platelet-Derived Growth Factor Beta Polypeptide; PDGF2; Platelet-Derived Growth Factor Subunit B; Platelet-Derived Growth Factor, Beta Polypeptide (Oncogene SIS); Platelet-Derived Growth

  • AA Sequence

    SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT

  • Predicted Molecular Mass

    13 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Sodium Citrate, pH 4.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00