1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. PRDX1 Protein, Mouse (His)

The PRDX1 protein is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols.Its key role in cellular protection against oxidative stress includes detoxifying superoxide and acting as a sensor of hydrogen peroxide-mediated signaling events.PRDX1 Protein, Mouse (His) is the recombinant mouse-derived PRDX1 protein, expressed by E.coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PRDX1 protein is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols.Its key role in cellular protection against oxidative stress includes detoxifying superoxide and acting as a sensor of hydrogen peroxide-mediated signaling events.PRDX1 Protein, Mouse (His) is the recombinant mouse-derived PRDX1 protein, expressed by E.coli , with C-His labeled tag.

Background

PRDX1, a thiol-specific peroxidase, functions as a catalyst for the reduction of hydrogen peroxide and organic hydroperoxides, converting them into water and alcohols, respectively. Its pivotal role in cell protection against oxidative stress involves detoxifying peroxides and acting as a sensor for hydrogen peroxide-mediated signaling events. Additionally, PRDX1 may contribute to the signaling cascades initiated by growth factors and tumor necrosis factor-alpha, exerting control over intracellular H(2)O(2) concentrations. Notably, PRDX1 exhibits the ability to reduce an intramolecular disulfide bond in GDPD5, thereby modulating GDPD5's capacity to drive postmitotic motor neuron differentiation. These diverse functions underscore the versatile and intricate regulatory roles of PRDX1 in cellular processes associated with redox signaling and differentiation.

Biological Activity

Defined as the amount of hydroperoxide that 1μg of PRDX1 can reduce at 25℃ for 1 minute. The specific activity is 7064.257 pmol/min/μg, as measured under the described conditions.

Assay Procedure

Materials
30% H2O2
PRDX1 Protein, Mouse (His) (HY-P73713)

Procedure
1. Dilute 30% H2O2 to concentrations of 0.3058, 0.1529, 0.076, 0.038, 0.019, 0.0096, 0.0047, and 0 mol/L. Add 100 μL of each concentration to the wells and measure the absorbance at 240 nm.
2. Dilute H2O2 to 0.4 mol/L.
3. Dilute Mouse PRDX1 to 166 μg/mL.
4. In a 96-well plate, add 50 μL of 0.4 mol/L hydrogen peroxide and 50 μL Mouse PRDX1.
5. Read the initial absorbance at 240 nm.
6. Incubate at room temperature for 20 minutes and read the absorbance again.
7. Calculate specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Abs * (OD) x Conversion Factor ** (pmol/RFU)
Incubation time (min) x amount of enzyme (μg)

*Adjusted for Substrate Blank
**Derived using calibration standard

Per Well:
Mouse PRDX1: 8.3 μg
H2O2: 0.2 M

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P35700 (M1-K199)

Gene ID
Molecular Construction
N-term
PRDX1 (M1-K199)
Accession # P35700
His
C-term
Protein Length

Full Length

Synonyms
Peroxiredoxin-1; OSF-3; PRDX1; Msp23; Paga; Tdpx2
AA Sequence

MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK

Molecular Weight

Approximately 27 kDa

Purity
  • ≥ 85%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PRDX1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRDX1 Protein, Mouse (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRDX1 Protein, Mouse (His)
Cat. No.:
HY-P73713
Quantity:
MCE Japan Authorized Agent: